Clone Sequence Records
BS11175.3prime Sequence
228 bp (227 high quality bases) assembled on 2006-04-19
> BS11175.3prime
ATGGTCTAGAAAGCTTTTAACATTTATAAAATTCGTTTATTGGGACATGT
TGGGTATCTACGAGTGTTTCAGGTACAATATGGTTGAACGTGTTTCGGCA
CCTGGCACATCCCCACTTCAGCAACAGCCTCTTGGTCCGCAGGGCATAAA
TGAGCACTGGATGTAGGCTGGGGTGCAGGGTACACAGCAGAGTTCCACGC
AGCAGTTGTAGCATGTCGACTGATAACT
BS11175.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17567-PA | 198 | CG17567-RA | 1..198 | 214..17 | 990 | 100 | Minus |
CG17567-PB | 198 | CG17567-RB | 1..198 | 214..17 | 990 | 100 | Minus |
CG17567-PC | 198 | CG17567-RC | 1..198 | 214..17 | 990 | 100 | Minus |
CG17567-PD | 198 | CG17567-RD | 1..198 | 214..17 | 990 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:19:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG46059-RC | 596 | CG46059-RC | 401..596 | 214..19 | 980 | 100 | Minus |
CG46059-RB | 409 | CG46059-RB | 214..409 | 214..19 | 980 | 100 | Minus |
CG46059-RA | 405 | CG46059-RA | 210..405 | 214..19 | 980 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:19:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19183091..19183288 | 17..214 | 990 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 20:19:49 has no hits.
BS11175.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:00:58 Download gff for
BS11175.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17567-PB | 1..198 | 17..214 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:28:57 Download gff for
BS11175.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17567-PD | 1..198 | 17..214 | 100 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:10:14 Download gff for
BS11175.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG46059-RA | 207..405 | 19..218 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 22:10:14 Download gff for
BS11175.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19183085..19183291 | 11..218 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 20:37:14 Download gff for
BS11175.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19183085..19183291 | 11..218 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 20:37:14 Download gff for
BS11175.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19183085..19183291 | 11..218 | 98 | | Plus |
BS11175.5prime Sequence
228 bp (227 high quality bases) assembled on 2006-04-19
> BS11175.5prime
GAAGTTATCAGTCGACATGCTACAACTGCTGCGTGGAACTCTGCTGTGTA
CCCTGCACCCCAGCCTACATCCAGTGCTCATTTATGCCCTGCGGACCAAG
AGGCTGTTGCTGAAGTGGGGATGTGCCAGGTGCCGAAACACGTTCAACCA
TATTGTACCTGAAACACTCGTAGATACCCAACATGTCCCAATAAACGAAT
TTTATAAATGTTAAAAGCTTTCTAGACC
BS11175.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17567-PA | 198 | CG17567-RA | 1..198 | 17..214 | 990 | 100 | Plus |
CG17567-PB | 198 | CG17567-RB | 1..198 | 17..214 | 990 | 100 | Plus |
CG17567-PC | 198 | CG17567-RC | 1..198 | 17..214 | 990 | 100 | Plus |
CG17567-PD | 198 | CG17567-RD | 1..198 | 17..214 | 990 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:05:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG46059-RC | 596 | CG46059-RC | 401..596 | 17..212 | 980 | 100 | Plus |
CG46059-RB | 409 | CG46059-RB | 214..409 | 17..212 | 980 | 100 | Plus |
CG46059-RA | 405 | CG46059-RA | 210..405 | 17..212 | 980 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:05:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19183091..19183288 | 214..17 | 990 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 05:05:22 has no hits.
BS11175.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:00:59 Download gff for
BS11175.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17567-PB | 1..198 | 17..214 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:28:59 Download gff for
BS11175.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17567-PD | 1..198 | 17..214 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:28:33 Download gff for
BS11175.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG46059-RA | 207..405 | 13..212 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:28:33 Download gff for
BS11175.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19183085..19183291 | 13..220 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 03:55:14 Download gff for
BS11175.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19183085..19183291 | 13..220 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 03:55:14 Download gff for
BS11175.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19183085..19183291 | 13..220 | 98 | | Minus |
BS11175.complete Sequence
230 bp assembled on 2006-11-01
GenBank Submission: FJ636776
> BS11175.complete
GAAGTTATCAGTCGACATGCTACAACTGCTGCGTGGAACTCTGCTGTGTA
CCCTGCACCCCAGCCTACATCCAGTGCTCATTTATGCCCTGCGGACCAAG
AGGCTGTTGCTGAAGTGGGGATGTGCCAGGTGCCGAAACACGTTCAACCA
TATTGTACCTGAAACACTCGTAGATACCCAACATGTCCCAATAAACGAAT
TTTATAAATGTTAAAAGCTTTCTAGACCAT
BS11175.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:26:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG46059-RC | 144 | CG46059-PC | 48..144 | 17..113 | 485 | 100 | Plus |
CG46059-RB | 144 | CG46059-PB | 48..144 | 17..113 | 485 | 100 | Plus |
CG46059-RA | 144 | CG46059-PA | 48..144 | 17..113 | 485 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:26:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG46059-RC | 596 | CG46059-RC | 401..596 | 17..212 | 980 | 100 | Plus |
CG46059-RB | 409 | CG46059-RB | 214..409 | 17..212 | 980 | 100 | Plus |
CG46059-RA | 405 | CG46059-RA | 210..405 | 17..212 | 980 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:26:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19183091..19183288 | 214..17 | 990 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 00:26:53 has no hits.
BS11175.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:08 Download gff for
BS11175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17567-RC | 1..198 | 17..214 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:03 Download gff for
BS11175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17567-RA | 220..420 | 13..214 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:08 Download gff for
BS11175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17567-RA | 220..420 | 13..214 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:32:00 Download gff for
BS11175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG46059-RA | 210..405 | 17..212 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:32:00 Download gff for
BS11175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19183093..19183288 | 17..212 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:24:44 Download gff for
BS11175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19183093..19183288 | 17..212 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:24:44 Download gff for
BS11175.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19183093..19183288 | 17..212 | 100 | | Minus |
BS11175.pep Sequence
Translation from 16 to 213
> BS11175.pep
MLQLLRGTLLCTLHPSLHPVLIYALRTKRLLLKWGCARCRNTFNHIVPET
LVDTQHVPINEFYKC*
Sequence BS11175.pep has no blast hits.