Clone BS11175 Report

Search the DGRC for BS11175

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:111
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG17567-RA
Protein status:BS11175.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11175.3prime Sequence

228 bp (227 high quality bases) assembled on 2006-04-19

> BS11175.3prime
ATGGTCTAGAAAGCTTTTAACATTTATAAAATTCGTTTATTGGGACATGT
TGGGTATCTACGAGTGTTTCAGGTACAATATGGTTGAACGTGTTTCGGCA
CCTGGCACATCCCCACTTCAGCAACAGCCTCTTGGTCCGCAGGGCATAAA
TGAGCACTGGATGTAGGCTGGGGTGCAGGGTACACAGCAGAGTTCCACGC
AGCAGTTGTAGCATGTCGACTGATAACT

BS11175.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG17567-PA 198 CG17567-RA 1..198 214..17 990 100 Minus
CG17567-PB 198 CG17567-RB 1..198 214..17 990 100 Minus
CG17567-PC 198 CG17567-RC 1..198 214..17 990 100 Minus
CG17567-PD 198 CG17567-RD 1..198 214..17 990 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG46059-RC 596 CG46059-RC 401..596 214..19 980 100 Minus
CG46059-RB 409 CG46059-RB 214..409 214..19 980 100 Minus
CG46059-RA 405 CG46059-RA 210..405 214..19 980 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19183091..19183288 17..214 990 100 Plus
Blast to na_te.dros performed on 2015-02-10 20:19:49 has no hits.

BS11175.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:00:58 Download gff for BS11175.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17567-PB 1..198 17..214 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:28:57 Download gff for BS11175.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17567-PD 1..198 17..214 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:10:14 Download gff for BS11175.3prime
Subject Subject Range Query Range Percent Splice Strand
CG46059-RA 207..405 19..218 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 22:10:14 Download gff for BS11175.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 19183085..19183291 11..218 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 20:37:14 Download gff for BS11175.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183085..19183291 11..218 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 20:37:14 Download gff for BS11175.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183085..19183291 11..218 98   Plus

BS11175.5prime Sequence

228 bp (227 high quality bases) assembled on 2006-04-19

> BS11175.5prime
GAAGTTATCAGTCGACATGCTACAACTGCTGCGTGGAACTCTGCTGTGTA
CCCTGCACCCCAGCCTACATCCAGTGCTCATTTATGCCCTGCGGACCAAG
AGGCTGTTGCTGAAGTGGGGATGTGCCAGGTGCCGAAACACGTTCAACCA
TATTGTACCTGAAACACTCGTAGATACCCAACATGTCCCAATAAACGAAT
TTTATAAATGTTAAAAGCTTTCTAGACC

BS11175.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG17567-PA 198 CG17567-RA 1..198 17..214 990 100 Plus
CG17567-PB 198 CG17567-RB 1..198 17..214 990 100 Plus
CG17567-PC 198 CG17567-RC 1..198 17..214 990 100 Plus
CG17567-PD 198 CG17567-RD 1..198 17..214 990 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG46059-RC 596 CG46059-RC 401..596 17..212 980 100 Plus
CG46059-RB 409 CG46059-RB 214..409 17..212 980 100 Plus
CG46059-RA 405 CG46059-RA 210..405 17..212 980 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19183091..19183288 214..17 990 100 Minus
Blast to na_te.dros performed on 2015-02-12 05:05:22 has no hits.

BS11175.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:00:59 Download gff for BS11175.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17567-PB 1..198 17..214 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:28:59 Download gff for BS11175.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17567-PD 1..198 17..214 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:28:33 Download gff for BS11175.5prime
Subject Subject Range Query Range Percent Splice Strand
CG46059-RA 207..405 13..212 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:28:33 Download gff for BS11175.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 19183085..19183291 13..220 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 03:55:14 Download gff for BS11175.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183085..19183291 13..220 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 03:55:14 Download gff for BS11175.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183085..19183291 13..220 98   Minus

BS11175.complete Sequence

230 bp assembled on 2006-11-01

GenBank Submission: FJ636776

> BS11175.complete
GAAGTTATCAGTCGACATGCTACAACTGCTGCGTGGAACTCTGCTGTGTA
CCCTGCACCCCAGCCTACATCCAGTGCTCATTTATGCCCTGCGGACCAAG
AGGCTGTTGCTGAAGTGGGGATGTGCCAGGTGCCGAAACACGTTCAACCA
TATTGTACCTGAAACACTCGTAGATACCCAACATGTCCCAATAAACGAAT
TTTATAAATGTTAAAAGCTTTCTAGACCAT

BS11175.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:26:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG46059-RC 144 CG46059-PC 48..144 17..113 485 100 Plus
CG46059-RB 144 CG46059-PB 48..144 17..113 485 100 Plus
CG46059-RA 144 CG46059-PA 48..144 17..113 485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG46059-RC 596 CG46059-RC 401..596 17..212 980 100 Plus
CG46059-RB 409 CG46059-RB 214..409 17..212 980 100 Plus
CG46059-RA 405 CG46059-RA 210..405 17..212 980 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19183091..19183288 214..17 990 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:26:53 has no hits.

BS11175.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:08 Download gff for BS11175.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RC 1..198 17..214 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:03 Download gff for BS11175.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RA 220..420 13..214 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:08 Download gff for BS11175.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RA 220..420 13..214 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:32:00 Download gff for BS11175.complete
Subject Subject Range Query Range Percent Splice Strand
CG46059-RA 210..405 17..212 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:32:00 Download gff for BS11175.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19183093..19183288 17..212 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:24:44 Download gff for BS11175.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183093..19183288 17..212 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:24:44 Download gff for BS11175.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183093..19183288 17..212 100   Minus

BS11175.pep Sequence

Translation from 16 to 213

> BS11175.pep
MLQLLRGTLLCTLHPSLHPVLIYALRTKRLLLKWGCARCRNTFNHIVPET
LVDTQHVPINEFYKC*
Sequence BS11175.pep has no blast hits.