Clone BS11178 Report

Search the DGRC for BS11178

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:111
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCoVIII-RA
Protein status:BS11178.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11178.complete Sequence

239 bp assembled on 2006-11-01

GenBank Submission: FJ636777

> BS11178.complete
GAAGTTATCAGTCGACATGTTCCAAAACAGCGCTGCCCGCCTCCTGGTCC
CCGCTATGCGTAGCGCCATGCAGAGCCGTTGCCAGTCGGTCGTCTCTGGA
CCTCCGACCCAGCGCATCTCCACCGCCGAGAAGGTGATCCTCGGCGGCGG
CATGTGCGCTGCATCCTTGTTCATTCCCGCCTGGGTGCTCTACCACATCC
GGGACTACAAGGGCGACAAGTAAAAGCTTTCTAGACCAT

BS11178.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
CoVIII-RA 207 CG7181-PA 1..207 17..223 1035 100 Plus
CoVIII-RB 207 CG7181-PB 1..207 17..223 1035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
CoVIII-RA 406 CG7181-RA 94..300 17..223 1035 100 Plus
CoVIII-RB 513 CG7181-RB 94..300 17..223 1035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21539243..21539354 128..17 560 100 Minus
3L 28110227 3L 21539072..21539167 223..128 480 100 Minus
Blast to na_te.dros performed on 2014-11-27 19:38:24 has no hits.

BS11178.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:17 Download gff for BS11178.complete
Subject Subject Range Query Range Percent Splice Strand
CG7181-RA 1..207 17..223 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:10 Download gff for BS11178.complete
Subject Subject Range Query Range Percent Splice Strand
CG7181-RA 88..303 11..228 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:01:37 Download gff for BS11178.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIII-RB 99..298 22..221 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:17 Download gff for BS11178.complete
Subject Subject Range Query Range Percent Splice Strand
CG7181-RA 88..303 11..228 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:05:23 Download gff for BS11178.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIII-RB 99..298 22..221 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:05:23 Download gff for BS11178.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21539074..21539167 128..221 100 <- Minus
3L 21539244..21539349 22..127 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:01:37 Download gff for BS11178.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21532174..21532267 128..221 100 <- Minus
arm_3L 21532344..21532449 22..127 100   Minus

BS11178.5prime Sequence

237 bp (236 high quality bases) assembled on 2006-04-19

> BS11178.5prime
GAAGTTATCAGTCGACATGTTCCAAAACAGCGCTGCCCGCCTCCTGGTCC
CCGCTATGCGTAGCGCCATGCAGAGCCGTTGCCAGTCGGTCGTCTCTGGA
CCTCCGACCCAGCGCATCTCCACCGCCGAGAAGGTGATCCTCGGCGGCGG
CATGTGCGCTGCATCCTTGTTCATTCCCGCCTGGGTGCTCTACCACATCC
GGGACTACAAGGGCGACAAGTAAAAGCTTTCTAGACC

BS11178.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG7181-PA 207 CG7181-RA 1..207 17..223 1035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
CoVIII-RA 406 CG7181-RA 94..300 17..223 1035 100 Plus
CoVIII-RB 513 CG7181-RB 94..300 17..223 1035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21539243..21539354 128..17 560 100 Minus
3L 28110227 3L 21539072..21539167 223..128 480 100 Minus
Blast to na_te.dros performed on 2015-02-11 16:28:58 has no hits.

BS11178.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:07 Download gff for BS11178.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7181-PA 1..207 17..223 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:07 Download gff for BS11178.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7181-PA 1..207 17..223 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 16:44:18 Download gff for BS11178.5prime
Subject Subject Range Query Range Percent Splice Strand
CoVIII-RB 88..303 11..228 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:18:28 Download gff for BS11178.5prime
Subject Subject Range Query Range Percent Splice Strand
CoVIII-RB 88..303 11..228 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:18:28 Download gff for BS11178.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 21539069..21539167 128..228 97 <- Minus
3L 21539244..21539360 11..127 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 16:44:18 Download gff for BS11178.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21532169..21532267 128..228 97 <- Minus
arm_3L 21532344..21532460 11..127 97   Minus

BS11178.3prime Sequence

237 bp (236 high quality bases) assembled on 2006-04-19

> BS11178.3prime
ATGGTCTAGAAAGCTTTTACTTGTCGCCCTTGTAGTCCCGGATGTGGTAG
AGCACCCAGGCGGGAATGAACAAGGATGCAGCGCACATGCCGCCGCCGAG
GATCACCTTCTCGGCGGTGGAGATGCGCTGGGTCGGAGGTCCAGAGACGA
CCGACTGGCAACGGCTCTGCATGGCGCTACGCATAGCGGGGACCAGGAGG
CGGGCAGCGCTGTTTTGGAACATGTCGACTGATAACT

BS11178.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG7181-PA 207 CG7181-RA 1..207 223..17 1035 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
CoVIII-RA 406 CG7181-RA 94..300 223..17 1035 100 Minus
CoVIII-RB 513 CG7181-RB 94..300 223..17 1035 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 13:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21539243..21539354 112..223 560 100 Plus
3L 28110227 3L 21539072..21539167 17..112 480 100 Plus
Blast to na_te.dros performed on 2015-02-12 13:44:34 has no hits.

BS11178.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:06 Download gff for BS11178.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7181-PA 1..207 17..223 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:06 Download gff for BS11178.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7181-PA 1..207 17..223 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 10:27:52 Download gff for BS11178.3prime
Subject Subject Range Query Range Percent Splice Strand
CoVIII-RB 88..303 12..229 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:58:54 Download gff for BS11178.3prime
Subject Subject Range Query Range Percent Splice Strand
CoVIII-RB 88..303 12..229 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 17:58:54 Download gff for BS11178.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 21539069..21539167 12..112 97 <- Plus
3L 21539244..21539360 113..229 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 10:27:52 Download gff for BS11178.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21532169..21532267 12..112 97 <- Plus
arm_3L 21532344..21532460 113..229 97   Plus

BS11178.pep Sequence

Translation from 16 to 222

> BS11178.pep
MFQNSAARLLVPAMRSAMQSRCQSVVSGPPTQRISTAEKVILGGGMCAAS
LFIPAWVLYHIRDYKGDK*

BS11178.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
CoVIII-PA 68 CG7181-PA 1..68 1..68 350 100 Plus
CoVIII-PB 68 CG7181-PB 1..68 1..68 350 100 Plus