Clone BS11179 Report

Search the DGRC for BS11179

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:111
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptCG8369-RA
Protein status:BS11179.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11179.3prime Sequence

315 bp (314 high quality bases) assembled on 2006-04-19

> BS11179.3prime
ATGGTCTAGAAAGCTTCTAGGACAGGCGAACGCTCACTCCACCGCCGCAC
TCGCCCTTGGACTTCTGCTCGAATGGATCGTCGGCATGCTGGCAGTTGTA
GTTGGCCATGACGCACGGGCTGCCAAAGGTGAGGAGGCGCTCCTTGCTGC
TGTTTTTGGCCTTGGCACAAACGGGCTCGTAGACTTCACCGCAGTTGTGC
TGGCAACTGTTGGTGGCCGGCTTCTTGGTGTCCTTGGCCGGAGGAGCCAG
GACGAATGCCAGCAAGCACAGTGCTAGAAAAGCAAACAGAGCGAAACGCA
TGTCGACTGATAACT

BS11179.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-PA 285 CG8369-RA 1..285 301..17 1400 99.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 03:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-RA 431 CG8369-RA 91..378 301..14 1425 99.7 Minus
CG8369-RC 774 CG8369-RC 459..721 276..14 1300 99.6 Minus
CG8369-RB 479 CG8369-RB 166..426 274..14 1290 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 03:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8822466..8822666 276..76 990 99.5 Minus
3R 32079331 3R 8822724..8822785 75..14 310 100 Minus
Blast to na_te.dros performed on 2015-02-09 03:35:02 has no hits.

BS11179.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:08 Download gff for BS11179.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-PA 1..285 17..301 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:09 Download gff for BS11179.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-PA 1..285 17..301 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-12 07:56:34 Download gff for BS11179.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 78..378 14..315 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 05:27:50 Download gff for BS11179.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 78..378 14..315 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 05:27:50 Download gff for BS11179.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 8822469..8822666 76..273 99 -> Minus
3R 8822724..8822785 14..75 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-12 07:56:34 Download gff for BS11179.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4648191..4648388 76..273 99 -> Minus
arm_3R 4648446..4648507 14..75 100   Minus

BS11179.5prime Sequence

315 bp (314 high quality bases) assembled on 2006-04-19

> BS11179.5prime
GAAGTTATCAGTCGACATGCGTTTCGCTCTGTTTGCTTTTCTAGCACTGT
GCTTGCTGGCATTCGTCCTGGCTACTCCGGCCAAGGACACCAAGAAGCCG
GCCACCAACAGTTGCCAGCACAACTGCGGTGAAGTCTACGAGCCCGTTTG
TGCCAAGGCCAAAAACAGCAGCAAGGAGCGCCTCCTCACCTTTGGCAGCC
CGTGCGTCATGGCCAACTACAACTGCCAGCATGCCGACGATCCATTCGAG
CAGAAGTCCAAGGGCGAGTGCGGCGGTGGAGTGAGCGTTCGCCTGTCCTA
GAAGCTTTCTAGACC

BS11179.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-PA 285 CG8369-RA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-RA 431 CG8369-RA 91..378 17..304 1440 100 Plus
CG8369-RC 774 CG8369-RC 459..721 42..304 1315 100 Plus
CG8369-RB 479 CG8369-RB 166..426 44..304 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8822466..8822666 42..242 1005 100 Plus
3R 32079331 3R 8822724..8822785 243..304 310 100 Plus
Blast to na_te.dros performed on 2015-02-12 05:05:31 has no hits.

BS11179.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:09 Download gff for BS11179.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-PA 1..285 17..301 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:10 Download gff for BS11179.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-PA 1..285 17..301 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 03:55:15 Download gff for BS11179.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 79..378 5..304 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:28:49 Download gff for BS11179.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 79..378 5..304 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:28:49 Download gff for BS11179.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 8822469..8822666 45..242 100 -> Plus
3R 8822724..8822785 243..304 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 03:55:15 Download gff for BS11179.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4648191..4648388 45..242 100 -> Plus
arm_3R 4648446..4648507 243..304 100   Plus

BS11179.complete Sequence

317 bp assembled on 2006-11-01

GenBank Submission: FJ636778

> BS11179.complete
GAAGTTATCAGTCGACATGCGTTTCGCTCTGTTTGCTTTTCTAGCACTGT
GCTTGCTGGCATTCGTCCTGGCTACTCCGGCCAAGGACACCAAGAAGCCG
GCCACCAACAGTTGCCAGCACAACTGCGGTGAAGTCTACGAGCCCGTTTG
TGCCAAGGCCAAAAACAGCAGCAAGGAGCGCCTCCTCACCTTTGGCAGCC
CGTGCGTCATGGCCAACTACAACTGCCAGCATGCCGACGATCCATTCGAG
CAGAAGTCCAAGGGCGAGTGCGGCGGTGGAGTGAGCGTTCGCCTGTCCTA
GAAGCTTTCTAGACCAT

BS11179.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-RA 285 CG8369-PA 1..285 17..301 1425 100 Plus
CG8369-RC 93 CG8369-PC 1..93 209..301 465 100 Plus
CG8369-RB 93 CG8369-PB 1..93 209..301 465 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-RA 431 CG8369-RA 91..378 17..304 1440 100 Plus
CG8369-RC 774 CG8369-RC 459..721 42..304 1315 100 Plus
CG8369-RB 479 CG8369-RB 166..426 44..304 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8822466..8822666 42..242 1005 100 Plus
3R 32079331 3R 8822724..8822785 243..304 310 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:45:09 has no hits.

BS11179.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:18:46 Download gff for BS11179.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 1..285 17..301 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:59 Download gff for BS11179.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 68..367 5..304 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:30:54 Download gff for BS11179.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 91..375 17..301 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:18:46 Download gff for BS11179.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 68..367 5..304 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:37:18 Download gff for BS11179.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 91..375 17..301 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:37:18 Download gff for BS11179.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8822098..8822125 17..44 100 -> Plus
3R 8822469..8822666 45..242 100 -> Plus
3R 8822724..8822782 243..301 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:30:54 Download gff for BS11179.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4647820..4647847 17..44 100 -> Plus
arm_3R 4648191..4648388 45..242 100 -> Plus
arm_3R 4648446..4648504 243..301 100   Plus

BS11179.pep Sequence

Translation from 16 to 300

> BS11179.pep
MRFALFAFLALCLLAFVLATPAKDTKKPATNSCQHNCGEVYEPVCAKAKN
SSKERLLTFGSPCVMANYNCQHADDPFEQKSKGECGGGVSVRLS*

BS11179.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-PA 94 CG8369-PA 1..94 1..94 505 100 Plus
CG8369-PC 30 CG8369-PC 1..30 65..94 166 100 Plus
CG8369-PB 30 CG8369-PB 1..30 65..94 166 100 Plus