Clone BS11180 Report

Search the DGRC for BS11180

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:111
Well:80
Vector:pDNR-Dual
Associated Gene/Transcriptobsolete transcript model
Protein status:BS11180.pep:
Sequenced Size:16

Clone Sequence Records

BS11180.3prime Sequence

282 bp (281 high quality bases) assembled on 2006-04-19

> BS11180.3prime
ATGGTCTAGAAAGCTTTTAGACGTTCAGCAAGAGTGCGAAAGTTGGCTGT
TTATTTGGTGTAGGGCTCGACCCACTTCCACTCCTCCCAGACGACGCAGT
TCTGCTGCTGCTCCATGAAGGCGTAGTTGTCCGGGCACTGGATGTAGTCA
GCCTTCTCCTGACCCTCGGGGCACACCCAGTAGTGGGTGGGGTCCGAGAT
GTCGCGGAACTTGCGAGCGTGATCCTCGACAATGGCGCAATTGGGCTCGG
CATAGATGTCTTGGCCATGTCGACTGATAACT

BS11180.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG7710-PA 252 CG7710-RA 1..252 268..17 1260 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG34282-RB 675 CG34282-RB 82..333 268..17 1260 100 Minus
CG34282-RA 462 CG34282-RA 82..333 268..17 1260 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18695402..18695653 268..17 1260 100 Minus
Blast to na_te.dros performed on 2015-02-10 20:19:52 has no hits.

BS11180.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:10 Download gff for BS11180.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7710-PA 1..252 17..268 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:12 Download gff for BS11180.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7710-PA 1..252 17..268 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 20:37:15 Download gff for BS11180.3prime
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 72..335 13..277 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:10:26 Download gff for BS11180.3prime
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 72..335 13..277 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 22:10:26 Download gff for BS11180.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 18695392..18695655 13..277 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 20:37:15 Download gff for BS11180.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14521114..14521377 13..277 97   Minus

BS11180.complete Sequence

284 bp assembled on 2006-11-01

> BS11180.complete
GAAGTTATCAGTCGACATGGCCAAGACATCTATGCCGAGCCCAATTGCGC
CATTGTCGAGGATCACGCTCGCAAGTTCCGCGACATCTCGGACCCCACCC
ACTACTGGGTGTGCCCCGAGGGTCAGGAGAAGGCTGACTACATCCAGTGC
CCGGACAACTACGCCTTCATGGAGCAGCAGCAGAACTGCGTCGTCTGGGA
GGAGTGGAAGTGGGTCGAGCCCTACACCAAATAAACAGCCAACTTTCGCA
CTCTTGCTGAACGTCTAAAAGCTTTCTAGACCAT

BS11180.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 21:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG34282-RB 285 CG34282-PB 68..285 17..234 1090 100 Plus
CG34282-RA 285 CG34282-PA 68..285 17..234 1090 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG34282-RB 675 CG34282-RB 82..333 17..268 1260 100 Plus
CG34282-RA 462 CG34282-RA 82..333 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 21:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18695402..18695653 17..268 1260 100 Plus
Blast to na_te.dros performed on 2014-11-27 21:03:09 has no hits.

BS11180.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:11:54 Download gff for BS11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 58..285 8..234 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:33 Download gff for BS11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 58..321 8..272 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:15:41 Download gff for BS11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 82..331 17..266 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:11:54 Download gff for BS11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 58..321 8..272 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:33:41 Download gff for BS11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 82..331 17..266 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:33:41 Download gff for BS11180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18695402..18695651 17..266 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:15:41 Download gff for BS11180.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14521124..14521373 17..266 100   Plus

BS11180.5prime Sequence

282 bp (281 high quality bases) assembled on 2006-04-19

> BS11180.5prime
GAAGTTATCAGTCGACATGGCCAAGACATCTATGCCGAGCCCAATTGCGC
CATTGTCGAGGATCACGCTCGCAAGTTCCGCGACATCTCGGACCCCACCC
ACTACTGGGTGTGCCCCGAGGGTCAGGAGAAGGCTGACTACATCCAGTGC
CCGGACAACTACGCCTTCATGGAGCAGCAGCAGAACTGCGTCGTCTGGGA
GGAGTGGAAGTGGGTCGAGCCCTACACCAAATAAACAGCCAACTTTCGCA
CTCTTGCTGAACGTCTAAAAGCTTTCTAGACC

BS11180.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG7710-PA 252 CG7710-RA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34282-RB 675 CG34282-RB 82..333 17..268 1260 100 Plus
CG34282-RA 462 CG34282-RA 82..333 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18695402..18695653 17..268 1260 100 Plus
Blast to na_te.dros performed on 2015-02-11 10:50:07 has no hits.

BS11180.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:11 Download gff for BS11180.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7710-PA 1..252 17..268 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:13 Download gff for BS11180.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7710-PA 1..252 17..268 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 16:38:33 Download gff for BS11180.5prime
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 72..335 8..272 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:25:48 Download gff for BS11180.5prime
Subject Subject Range Query Range Percent Splice Strand
CG34282-RA 72..335 8..272 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:25:48 Download gff for BS11180.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 18695392..18695655 8..272 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 16:38:33 Download gff for BS11180.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14521114..14521377 8..272 97   Plus

BS11180.pep Sequence

Translation from 16 to 267

> BS11180.pep
MAKTSMPSPIAPLSRITLASSATSRTPPTTGCAPRVRRRLTTSSARTTTP
SWSSSRTASSGRSGSGSSPTPNKQPTFALLLNV*
Sequence BS11180.pep has no blast hits.