Clone Sequence Records
BS11180.3prime Sequence
282 bp (281 high quality bases) assembled on 2006-04-19
> BS11180.3prime
ATGGTCTAGAAAGCTTTTAGACGTTCAGCAAGAGTGCGAAAGTTGGCTGT
TTATTTGGTGTAGGGCTCGACCCACTTCCACTCCTCCCAGACGACGCAGT
TCTGCTGCTGCTCCATGAAGGCGTAGTTGTCCGGGCACTGGATGTAGTCA
GCCTTCTCCTGACCCTCGGGGCACACCCAGTAGTGGGTGGGGTCCGAGAT
GTCGCGGAACTTGCGAGCGTGATCCTCGACAATGGCGCAATTGGGCTCGG
CATAGATGTCTTGGCCATGTCGACTGATAACT
BS11180.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7710-PA | 252 | CG7710-RA | 1..252 | 268..17 | 1260 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:19:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34282-RB | 675 | CG34282-RB | 82..333 | 268..17 | 1260 | 100 | Minus |
CG34282-RA | 462 | CG34282-RA | 82..333 | 268..17 | 1260 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:19:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18695402..18695653 | 268..17 | 1260 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 20:19:52 has no hits.
BS11180.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:10 Download gff for
BS11180.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7710-PA | 1..252 | 17..268 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:12 Download gff for
BS11180.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7710-PA | 1..252 | 17..268 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 20:37:15 Download gff for
BS11180.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34282-RA | 72..335 | 13..277 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:10:26 Download gff for
BS11180.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34282-RA | 72..335 | 13..277 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 22:10:26 Download gff for
BS11180.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18695392..18695655 | 13..277 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 20:37:15 Download gff for
BS11180.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14521114..14521377 | 13..277 | 97 | | Minus |
BS11180.complete Sequence
284 bp assembled on 2006-11-01
> BS11180.complete
GAAGTTATCAGTCGACATGGCCAAGACATCTATGCCGAGCCCAATTGCGC
CATTGTCGAGGATCACGCTCGCAAGTTCCGCGACATCTCGGACCCCACCC
ACTACTGGGTGTGCCCCGAGGGTCAGGAGAAGGCTGACTACATCCAGTGC
CCGGACAACTACGCCTTCATGGAGCAGCAGCAGAACTGCGTCGTCTGGGA
GGAGTGGAAGTGGGTCGAGCCCTACACCAAATAAACAGCCAACTTTCGCA
CTCTTGCTGAACGTCTAAAAGCTTTCTAGACCAT
BS11180.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 21:03:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34282-RB | 285 | CG34282-PB | 68..285 | 17..234 | 1090 | 100 | Plus |
CG34282-RA | 285 | CG34282-PA | 68..285 | 17..234 | 1090 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:03:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34282-RB | 675 | CG34282-RB | 82..333 | 17..268 | 1260 | 100 | Plus |
CG34282-RA | 462 | CG34282-RA | 82..333 | 17..268 | 1260 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 21:03:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18695402..18695653 | 17..268 | 1260 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 21:03:09 has no hits.
BS11180.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:11:54 Download gff for
BS11180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34282-RA | 58..285 | 8..234 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:33 Download gff for
BS11180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34282-RA | 58..321 | 8..272 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:15:41 Download gff for
BS11180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34282-RA | 82..331 | 17..266 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:11:54 Download gff for
BS11180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34282-RA | 58..321 | 8..272 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:33:41 Download gff for
BS11180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34282-RA | 82..331 | 17..266 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:33:41 Download gff for
BS11180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18695402..18695651 | 17..266 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:15:41 Download gff for
BS11180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14521124..14521373 | 17..266 | 100 | | Plus |
BS11180.5prime Sequence
282 bp (281 high quality bases) assembled on 2006-04-19
> BS11180.5prime
GAAGTTATCAGTCGACATGGCCAAGACATCTATGCCGAGCCCAATTGCGC
CATTGTCGAGGATCACGCTCGCAAGTTCCGCGACATCTCGGACCCCACCC
ACTACTGGGTGTGCCCCGAGGGTCAGGAGAAGGCTGACTACATCCAGTGC
CCGGACAACTACGCCTTCATGGAGCAGCAGCAGAACTGCGTCGTCTGGGA
GGAGTGGAAGTGGGTCGAGCCCTACACCAAATAAACAGCCAACTTTCGCA
CTCTTGCTGAACGTCTAAAAGCTTTCTAGACC
BS11180.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7710-PA | 252 | CG7710-RA | 1..252 | 17..268 | 1260 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:50:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34282-RB | 675 | CG34282-RB | 82..333 | 17..268 | 1260 | 100 | Plus |
CG34282-RA | 462 | CG34282-RA | 82..333 | 17..268 | 1260 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:50:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18695402..18695653 | 17..268 | 1260 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 10:50:07 has no hits.
BS11180.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:11 Download gff for
BS11180.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7710-PA | 1..252 | 17..268 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:13 Download gff for
BS11180.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7710-PA | 1..252 | 17..268 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 16:38:33 Download gff for
BS11180.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34282-RA | 72..335 | 8..272 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:25:48 Download gff for
BS11180.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34282-RA | 72..335 | 8..272 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:25:48 Download gff for
BS11180.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18695392..18695655 | 8..272 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 16:38:33 Download gff for
BS11180.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14521114..14521377 | 8..272 | 97 | | Plus |
BS11180.pep Sequence
Translation from 16 to 267
> BS11180.pep
MAKTSMPSPIAPLSRITLASSATSRTPPTTGCAPRVRRRLTTSSARTTTP
SWSSSRTASSGRSGSGSSPTPNKQPTFALLLNV*
Sequence BS11180.pep has no blast hits.