Clone Sequence Records
BS11185.3prime Sequence
228 bp (227 high quality bases) assembled on 2006-04-19
> BS11185.3prime
ATGGTCTAGAAAGCTTTTAGCGCAGCCTCCTGGCTTCACGTTCGGATTCC
AAAAGGGTCAGGATGTCGCCCTCGCGAACTGGTCCCTTCACGTTTCGGAT
AATCTGGCGGTTCTGCTCGCCCAGGAACTCGACCTTCACCTGGGTACACT
GACCCTGGGAGCCGGTGCGGCCCAGAACCTTCATGACGCGTGCCCACACA
ACTGGTTTGTCCATGTCGACTGATAACT
BS11185.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG2998-PA | 198 | RpS28b-RA | 1..198 | 214..17 | 990 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:41:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28b-RB | 972 | CG2998-RB | 86..285 | 216..17 | 1000 | 100 | Minus |
RpS28b-RA | 520 | CG2998-RA | 86..285 | 216..17 | 1000 | 100 | Minus |
RpS28a-RA | 304 | CG15527-RA | 93..243 | 169..19 | 335 | 81.5 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:41:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9554708..9554907 | 216..17 | 1000 | 100 | Minus |
3R | 32079331 | 3R | 30022406..30022556 | 19..169 | 335 | 81.5 | Plus |
Blast to na_te.dros performed on 2015-02-12 11:41:37 has no hits.
BS11185.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:21 Download gff for
BS11185.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2998-PA | 1..198 | 17..214 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:22 Download gff for
BS11185.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2998-PA | 1..198 | 17..214 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 10:29:25 Download gff for
BS11185.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 81..285 | 17..224 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 14:09:43 Download gff for
BS11185.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 81..285 | 17..224 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 14:09:43 Download gff for
BS11185.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9554703..9554907 | 17..224 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 10:29:25 Download gff for
BS11185.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9448736..9448940 | 17..224 | 98 | | Minus |
BS11185.5prime Sequence
228 bp (227 high quality bases) assembled on 2006-04-19
> BS11185.5prime
GAAGTTATCAGTCGACATGGACAAACCAGTTGTGTGGGCACGCGTCATGA
AGGTTCTGGGCCGCACCGGCTCCCAGGGTCAGTGTACCCAGGTGAAGGTC
GAGTTCCTGGGCGAGCAGAACCGCCAGATTATCCGAAACGTGAAGGGACC
AGTTCGCGAGGGCGACATCCTGACCCTTTTGGAATCCGAACGTGAAGCCA
GGAGGCTGCGCTAAAAGCTTTCTAGACC
BS11185.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG2998-PA | 198 | RpS28b-RA | 1..198 | 17..214 | 990 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 06:46:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28b-RB | 972 | CG2998-RB | 86..285 | 15..214 | 1000 | 100 | Plus |
RpS28b-RA | 520 | CG2998-RA | 86..285 | 15..214 | 1000 | 100 | Plus |
RpS28a-RA | 304 | CG15527-RA | 93..243 | 62..212 | 335 | 81.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 06:46:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9554708..9554907 | 15..214 | 1000 | 100 | Plus |
3R | 32079331 | 3R | 30022406..30022556 | 212..62 | 335 | 81.5 | Minus |
Blast to na_te.dros performed on 2015-02-10 06:46:34 has no hits.
BS11185.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:22 Download gff for
BS11185.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2998-PA | 1..198 | 17..214 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:24 Download gff for
BS11185.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2998-PA | 1..198 | 17..214 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 09:03:47 Download gff for
BS11185.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 81..285 | 7..214 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 07:40:18 Download gff for
BS11185.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 81..285 | 7..214 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 07:40:18 Download gff for
BS11185.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9554703..9554907 | 7..214 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 09:03:47 Download gff for
BS11185.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9448736..9448940 | 7..214 | 98 | | Plus |
BS11185.complete Sequence
230 bp assembled on 2006-11-01
GenBank Submission: FJ636780
> BS11185.complete
GAAGTTATCAGTCGACATGGACAAACCAGTTGTGTGGGCACGCGTCATGA
AGGTTCTGGGCCGCACCGGCTCCCAGGGTCAGTGTACCCAGGTGAAGGTC
GAGTTCCTGGGCGAGCAGAACCGCCAGATTATCCGAAACGTGAAGGGACC
AGTTCGCGAGGGCGACATCCTGACCCTTTTGGAATCCGAACGTGAAGCCA
GGAGGCTGCGCTAAAAGCTTTCTAGACCAT
BS11185.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:21:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28b-RB | 198 | CG2998-PB | 1..198 | 17..214 | 990 | 100 | Plus |
RpS28b-RA | 198 | CG2998-PA | 1..198 | 17..214 | 990 | 100 | Plus |
RpS28a-RA | 195 | CG15527-PA | 43..193 | 62..212 | 335 | 81.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:21:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28b-RB | 972 | CG2998-RB | 86..285 | 15..214 | 1000 | 100 | Plus |
RpS28b-RA | 520 | CG2998-RA | 86..285 | 15..214 | 1000 | 100 | Plus |
RpS28a-RA | 304 | CG15527-RA | 93..243 | 62..212 | 335 | 81.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:21:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9554708..9554907 | 15..214 | 1000 | 100 | Plus |
3R | 32079331 | 3R | 30022406..30022556 | 212..62 | 335 | 81.5 | Minus |
Blast to na_te.dros performed on 2014-11-27 15:21:41 has no hits.
BS11185.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:18 Download gff for
BS11185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 1..198 | 17..214 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:11 Download gff for
BS11185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 85..289 | 7..214 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:50:07 Download gff for
BS11185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 88..283 | 17..212 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:18 Download gff for
BS11185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 85..289 | 7..214 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:05:51 Download gff for
BS11185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 88..283 | 17..212 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:05:51 Download gff for
BS11185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9554710..9554905 | 17..212 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:50:07 Download gff for
BS11185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9448743..9448938 | 17..212 | 100 | | Plus |
BS11185.pep Sequence
Translation from 16 to 213
> BS11185.pep
MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGD
ILTLLESEREARRLR*
BS11185.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:35:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28b-PB | 65 | CG2998-PB | 1..65 | 1..65 | 329 | 100 | Plus |
RpS28b-PA | 65 | CG2998-PA | 1..65 | 1..65 | 329 | 100 | Plus |
RpS28a-PA | 64 | CG15527-PA | 1..64 | 1..65 | 264 | 81.5 | Plus |