Clone BS11185 Report

Search the DGRC for BS11185

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:111
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptRpS28b-RA
Protein status:BS11185.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11185.3prime Sequence

228 bp (227 high quality bases) assembled on 2006-04-19

> BS11185.3prime
ATGGTCTAGAAAGCTTTTAGCGCAGCCTCCTGGCTTCACGTTCGGATTCC
AAAAGGGTCAGGATGTCGCCCTCGCGAACTGGTCCCTTCACGTTTCGGAT
AATCTGGCGGTTCTGCTCGCCCAGGAACTCGACCTTCACCTGGGTACACT
GACCCTGGGAGCCGGTGCGGCCCAGAACCTTCATGACGCGTGCCCACACA
ACTGGTTTGTCCATGTCGACTGATAACT

BS11185.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG2998-PA 198 RpS28b-RA 1..198 214..17 990 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-RB 972 CG2998-RB 86..285 216..17 1000 100 Minus
RpS28b-RA 520 CG2998-RA 86..285 216..17 1000 100 Minus
RpS28a-RA 304 CG15527-RA 93..243 169..19 335 81.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9554708..9554907 216..17 1000 100 Minus
3R 32079331 3R 30022406..30022556 19..169 335 81.5 Plus
Blast to na_te.dros performed on 2015-02-12 11:41:37 has no hits.

BS11185.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:21 Download gff for BS11185.3prime
Subject Subject Range Query Range Percent Splice Strand
CG2998-PA 1..198 17..214 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:22 Download gff for BS11185.3prime
Subject Subject Range Query Range Percent Splice Strand
CG2998-PA 1..198 17..214 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 10:29:25 Download gff for BS11185.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 81..285 17..224 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 14:09:43 Download gff for BS11185.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 81..285 17..224 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 14:09:43 Download gff for BS11185.3prime
Subject Subject Range Query Range Percent Splice Strand
X 9554703..9554907 17..224 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 10:29:25 Download gff for BS11185.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9448736..9448940 17..224 98   Minus

BS11185.5prime Sequence

228 bp (227 high quality bases) assembled on 2006-04-19

> BS11185.5prime
GAAGTTATCAGTCGACATGGACAAACCAGTTGTGTGGGCACGCGTCATGA
AGGTTCTGGGCCGCACCGGCTCCCAGGGTCAGTGTACCCAGGTGAAGGTC
GAGTTCCTGGGCGAGCAGAACCGCCAGATTATCCGAAACGTGAAGGGACC
AGTTCGCGAGGGCGACATCCTGACCCTTTTGGAATCCGAACGTGAAGCCA
GGAGGCTGCGCTAAAAGCTTTCTAGACC

BS11185.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG2998-PA 198 RpS28b-RA 1..198 17..214 990 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 06:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-RB 972 CG2998-RB 86..285 15..214 1000 100 Plus
RpS28b-RA 520 CG2998-RA 86..285 15..214 1000 100 Plus
RpS28a-RA 304 CG15527-RA 93..243 62..212 335 81.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 06:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9554708..9554907 15..214 1000 100 Plus
3R 32079331 3R 30022406..30022556 212..62 335 81.5 Minus
Blast to na_te.dros performed on 2015-02-10 06:46:34 has no hits.

BS11185.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:22 Download gff for BS11185.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2998-PA 1..198 17..214 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:24 Download gff for BS11185.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2998-PA 1..198 17..214 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 09:03:47 Download gff for BS11185.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 81..285 7..214 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 07:40:18 Download gff for BS11185.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 81..285 7..214 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 07:40:18 Download gff for BS11185.5prime
Subject Subject Range Query Range Percent Splice Strand
X 9554703..9554907 7..214 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 09:03:47 Download gff for BS11185.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9448736..9448940 7..214 98   Plus

BS11185.complete Sequence

230 bp assembled on 2006-11-01

GenBank Submission: FJ636780

> BS11185.complete
GAAGTTATCAGTCGACATGGACAAACCAGTTGTGTGGGCACGCGTCATGA
AGGTTCTGGGCCGCACCGGCTCCCAGGGTCAGTGTACCCAGGTGAAGGTC
GAGTTCCTGGGCGAGCAGAACCGCCAGATTATCCGAAACGTGAAGGGACC
AGTTCGCGAGGGCGACATCCTGACCCTTTTGGAATCCGAACGTGAAGCCA
GGAGGCTGCGCTAAAAGCTTTCTAGACCAT

BS11185.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-RB 198 CG2998-PB 1..198 17..214 990 100 Plus
RpS28b-RA 198 CG2998-PA 1..198 17..214 990 100 Plus
RpS28a-RA 195 CG15527-PA 43..193 62..212 335 81.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-RB 972 CG2998-RB 86..285 15..214 1000 100 Plus
RpS28b-RA 520 CG2998-RA 86..285 15..214 1000 100 Plus
RpS28a-RA 304 CG15527-RA 93..243 62..212 335 81.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9554708..9554907 15..214 1000 100 Plus
3R 32079331 3R 30022406..30022556 212..62 335 81.5 Minus
Blast to na_te.dros performed on 2014-11-27 15:21:41 has no hits.

BS11185.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:18 Download gff for BS11185.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 1..198 17..214 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:11 Download gff for BS11185.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 85..289 7..214 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:50:07 Download gff for BS11185.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 88..283 17..212 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:18 Download gff for BS11185.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 85..289 7..214 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:05:51 Download gff for BS11185.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 88..283 17..212 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:05:51 Download gff for BS11185.complete
Subject Subject Range Query Range Percent Splice Strand
X 9554710..9554905 17..212 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:50:07 Download gff for BS11185.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9448743..9448938 17..212 100   Plus

BS11185.pep Sequence

Translation from 16 to 213

> BS11185.pep
MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGD
ILTLLESEREARRLR*

BS11185.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-PB 65 CG2998-PB 1..65 1..65 329 100 Plus
RpS28b-PA 65 CG2998-PA 1..65 1..65 329 100 Plus
RpS28a-PA 64 CG15527-PA 1..64 1..65 264 81.5 Plus