Clone Sequence Records
BS11189.3prime Sequence
276 bp (275 high quality bases) assembled on 2006-04-19
> BS11189.3prime
ATGGTCTAGAAAGCTTCTAGTGCTTGGGAGTGGGCTTCGAAAGCTCAGCC
AAGGCACGGGCCTCAGCCTCTGCGCTGCGCTTCTTCTCCTCGGCGAGCTT
GGCATCACGGACGGCCTTCTGCTGTGCCTCGATCTCGCGCAACTTCTCCT
CCTTCTTGGACAGGCGGCTCTGGTGGGCGGCGCCGTAGGCAATGCCCACC
AGGAGCAGGGACCATCTGCCGAACTTGATCAGCGGGGAAACGCGAACGGG
AGCCTGCGACATGTCGACTGATAACT
BS11189.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:04:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-PA | 246 | CG3321-RA | 1..246 | 262..17 | 1230 | 100 | Minus |
CG3321-PB | 246 | CG3321-RB | 1..246 | 262..17 | 1230 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 03:34:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-RC | 664 | CG3321-RC | 219..465 | 263..17 | 1235 | 100 | Minus |
CG3321-RB | 599 | CG3321-RB | 154..400 | 263..17 | 1235 | 100 | Minus |
CG3321-RA | 543 | CG3321-RA | 98..344 | 263..17 | 1235 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 03:34:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 14327290..14327536 | 263..17 | 1235 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-09 03:34:18 has no hits.
BS11189.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:29 Download gff for
BS11189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-PA | 1..246 | 17..262 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:33 Download gff for
BS11189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-PB | 1..246 | 17..262 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-12 07:56:27 Download gff for
BS11189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 98..354 | 6..263 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 05:27:46 Download gff for
BS11189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 98..354 | 6..263 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 05:27:46 Download gff for
BS11189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 14327290..14327546 | 6..263 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-12 07:56:27 Download gff for
BS11189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 10153012..10153268 | 6..263 | 98 | | Minus |
BS11189.5prime Sequence
276 bp (275 high quality bases) assembled on 2006-04-19
> BS11189.5prime
GAAGTTATCAGTCGACATGTCGCAGGCTCCCGTTCGCGTTTCCCCGCTGA
TCAAGTTCGGCAGATGGTCCCTGCTCCTGGTGGGCATTGCCTACGGCGCC
GCCCACCAGAGCCGCCTGTCCAAGAAGGAGGAGAAGTTGCGCGAGATCGA
GGCACAGCAGAAGGCCGTCCGTGATGCCAAGCTCGCCGAGGAGAAGAAGC
GCAGCGCAGAGGCTGAGGCCCGTGCCTTGGCTGAGCTTTCGAAGCCCACT
CCCAAGCACTAGAAGCTTTCTAGACC
BS11189.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:04:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-PA | 246 | CG3321-RA | 1..246 | 17..262 | 1230 | 100 | Plus |
CG3321-PB | 246 | CG3321-RB | 1..246 | 17..262 | 1230 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:58:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-RC | 664 | CG3321-RC | 219..465 | 16..262 | 1235 | 100 | Plus |
CG3321-RB | 599 | CG3321-RB | 154..400 | 16..262 | 1235 | 100 | Plus |
CG3321-RA | 543 | CG3321-RA | 98..344 | 16..262 | 1235 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 12:58:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 14327290..14327536 | 16..262 | 1235 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 12:58:09 has no hits.
BS11189.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:30 Download gff for
BS11189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-PA | 1..246 | 17..262 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:34 Download gff for
BS11189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-PB | 1..246 | 17..262 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 06:23:43 Download gff for
BS11189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 98..354 | 16..273 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 14:34:10 Download gff for
BS11189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 98..354 | 16..273 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 14:34:10 Download gff for
BS11189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 14327290..14327546 | 16..273 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 06:23:43 Download gff for
BS11189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 10153012..10153268 | 16..273 | 98 | | Plus |
BS11189.complete Sequence
278 bp assembled on 2006-11-01
GenBank Submission: FJ636781
> BS11189.complete
GAAGTTATCAGTCGACATGTCGCAGGCTCCCGTTCGCGTTTCCCCGCTGA
TCAAGTTCGGCAGATGGTCCCTGCTCCTGGTGGGCATTGCCTACGGCGCC
GCCCACCAGAGCCGCCTGTCCAAGAAGGAGGAGAAGTTGCGCGAGATCGA
GGCACAGCAGAAGGCCGTCCGTGATGCCAAGCTCGCCGAGGAGAAGAAGC
GCAGCGCAGAGGCTGAGGCCCGTGCCTTGGCTGAGCTTTCGAAGCCCACT
CCCAAGCACTAGAAGCTTTCTAGACCAT
BS11189.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:07:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-RC | 246 | CG3321-PC | 1..246 | 17..262 | 1230 | 100 | Plus |
CG3321-RB | 246 | CG3321-PB | 1..246 | 17..262 | 1230 | 100 | Plus |
CG3321-RA | 246 | CG3321-PA | 1..246 | 17..262 | 1230 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:07:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-RC | 664 | CG3321-RC | 219..465 | 16..262 | 1235 | 100 | Plus |
CG3321-RB | 599 | CG3321-RB | 154..400 | 16..262 | 1235 | 100 | Plus |
CG3321-RA | 543 | CG3321-RA | 98..344 | 16..262 | 1235 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:07:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 14327290..14327536 | 16..262 | 1235 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 00:07:55 has no hits.
BS11189.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:48:00 Download gff for
BS11189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RB | 1..246 | 17..262 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:58:57 Download gff for
BS11189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RB | 198..454 | 16..273 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:46:05 Download gff for
BS11189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 99..344 | 17..262 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:48:00 Download gff for
BS11189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RB | 198..454 | 16..273 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:14:57 Download gff for
BS11189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 99..344 | 17..262 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:14:57 Download gff for
BS11189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 14327291..14327536 | 17..262 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:46:05 Download gff for
BS11189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 10153013..10153258 | 17..262 | 100 | | Plus |
BS11189.pep Sequence
Translation from 16 to 261
> BS11189.pep
MSQAPVRVSPLIKFGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKA
VRDAKLAEEKKRSAEAEARALAELSKPTPKH*
BS11189.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:41:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-PC | 81 | CG3321-PC | 1..81 | 1..81 | 396 | 100 | Plus |
CG3321-PB | 81 | CG3321-PB | 1..81 | 1..81 | 396 | 100 | Plus |
CG3321-PA | 81 | CG3321-PA | 1..81 | 1..81 | 396 | 100 | Plus |