Clone BS11196 Report

Search the DGRC for BS11196

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:111
Well:96
Vector:pDNR-Dual
Associated Gene/TranscriptCdlc2-RA
Protein status:BS11196.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11196.5prime Sequence

300 bp (299 high quality bases) assembled on 2006-04-19

> BS11196.5prime
GAAGTTATCAGTCGACATGTCGGATCGCAAGGCGGTGATCAAGAACGCTG
ACATGAGCGAGGAGATGCAGCAGGACGCTGTTGACTGCGCCACCCAGGCC
CTGGAGAAGTACAACATCGAGAAGGACATCGCCGCCTTCATCAAGAAGGA
GTTCGACAAGAAGTACAACCCCACCTGGCACTGCATCGTGGGCCGCAACT
TCGGATCCTATGTGACCCACGAGACGCGCCACTTCATCTATTTCTACCTG
GGCCAGGTGGCCATTCTGCTCTTCAAGAGCGGTTAAAAGCTTTCTAGACC

BS11196.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG5450-PA 270 Cdlc2-RA 1..270 17..286 1350 100 Plus
CG5450-PB 270 Cdlc2-RB 1..270 17..286 1350 100 Plus
CG6998-PB 270 ctp-RB 79..218 95..234 250 87.1 Plus
CG6998-PD 270 ctp-RD 79..218 95..234 250 87.1 Plus
CG6998-PA 270 ctp-RA 79..218 95..234 250 87.1 Plus
CG6998-PC 270 ctp-RC 79..218 95..234 250 87.1 Plus
CG6998-PB 270 ctp-RB 1..59 17..75 145 89.8 Plus
CG6998-PD 270 ctp-RD 1..59 17..75 145 89.8 Plus
CG6998-PA 270 ctp-RA 1..59 17..75 145 89.8 Plus
CG6998-PC 270 ctp-RC 1..59 17..75 145 89.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-RC 671 CG5450-RC 152..422 17..287 1355 100 Plus
Cdlc2-RB 621 CG5450-RB 102..372 17..287 1355 100 Plus
Cdlc2-RA 675 CG5450-RA 156..426 17..287 1355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1344616..1344886 17..287 1355 100 Plus
X 23542271 X 4698295..4698459 123..287 450 84.8 Plus
X 23542271 X 4691737..4691845 17..125 305 85.3 Plus
Blast to na_te.dros performed on 2015-02-11 10:45:51 has no hits.

BS11196.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:44 Download gff for BS11196.5prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-PA 1..270 17..286 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:54 Download gff for BS11196.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5450-PA 1..270 17..286 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 16:37:31 Download gff for BS11196.5prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 145..437 7..300 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:25:02 Download gff for BS11196.5prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 145..437 7..300 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:25:02 Download gff for BS11196.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 1344605..1344897 7..300 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 16:37:31 Download gff for BS11196.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1344605..1344897 7..300 96   Plus

BS11196.3prime Sequence

300 bp (299 high quality bases) assembled on 2006-04-19

> BS11196.3prime
ATGGTCTAGAAAGCTTTTAACCGCTCTTGAAGAGCAGAATGGCCACCTGG
CCCAGGTAGAAATAGATGAAGTGGCGCGTCTCGTGGGTCACATAGGATCC
GAAGTTGCGGCCCACGATGCAGTGCCAGGTGGGGTTGTACTTCTTGTCGA
ACTCCTTCTTGATGAAGGCGGCGATGTCCTTCTCGATGTTGTACTTCTCC
AGGGCCTGGGTGGCGCAGTCAACAGCGTCCTGCTGCATCTCCTCGCTCAT
GTCAGCGTTCTTGATCACCGCCTTGCGATCCGACATGTCGACTGATAACT

BS11196.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG5450-PA 270 Cdlc2-RA 1..270 286..17 1350 100 Minus
CG5450-PB 270 Cdlc2-RB 1..270 286..17 1350 100 Minus
CG6998-PB 270 ctp-RB 79..218 208..69 250 87.1 Minus
CG6998-PD 270 ctp-RD 79..218 208..69 250 87.1 Minus
CG6998-PA 270 ctp-RA 79..218 208..69 250 87.1 Minus
CG6998-PC 270 ctp-RC 79..218 208..69 250 87.1 Minus
CG6998-PB 270 ctp-RB 1..59 286..228 145 89.8 Minus
CG6998-PD 270 ctp-RD 1..59 286..228 145 89.8 Minus
CG6998-PA 270 ctp-RA 1..59 286..228 145 89.8 Minus
CG6998-PC 270 ctp-RC 1..59 286..228 145 89.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-RC 671 CG5450-RC 152..422 286..16 1355 100 Minus
Cdlc2-RB 621 CG5450-RB 102..372 286..16 1355 100 Minus
Cdlc2-RA 675 CG5450-RA 156..426 286..16 1355 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1344616..1344886 286..16 1355 100 Minus
X 23542271 X 4698295..4698459 180..16 450 84.8 Minus
X 23542271 X 4691737..4691845 286..178 305 85.3 Minus
Blast to na_te.dros performed on 2015-02-10 22:12:37 has no hits.

BS11196.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:01:43 Download gff for BS11196.3prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-PA 1..270 17..286 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:29:52 Download gff for BS11196.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5450-PA 1..270 17..286 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 19:55:19 Download gff for BS11196.3prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 145..437 4..296 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:59:51 Download gff for BS11196.3prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 145..437 4..296 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:59:51 Download gff for BS11196.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 1344605..1344897 4..296 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 19:55:19 Download gff for BS11196.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1344605..1344897 4..296 97   Minus

BS11196.complete Sequence

302 bp assembled on 2006-11-01

GenBank Submission: FJ636783

> BS11196.complete
GAAGTTATCAGTCGACATGTCGGATCGCAAGGCGGTGATCAAGAACGCTG
ACATGAGCGAGGAGATGCAGCAGGACGCTGTTGACTGCGCCACCCAGGCC
CTGGAGAAGTACAACATCGAGAAGGACATCGCCGCCTTCATCAAGAAGGA
GTTCGACAAGAAGTACAACCCCACCTGGCACTGCATCGTGGGCCGCAACT
TCGGATCCTATGTGACCCACGAGACGCGCCACTTCATCTATTTCTACCTG
GGCCAGGTGGCCATTCTGCTCTTCAAGAGCGGTTAAAAGCTTTCTAGACC
AT

BS11196.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-RC 270 CG5450-PC 1..270 17..286 1350 100 Plus
Cdlc2-RB 270 CG5450-PB 1..270 17..286 1350 100 Plus
Cdlc2-RA 270 CG5450-PA 1..270 17..286 1350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-RC 671 CG5450-RC 152..422 17..287 1355 100 Plus
Cdlc2-RB 621 CG5450-RB 102..372 17..287 1355 100 Plus
Cdlc2-RA 675 CG5450-RA 156..426 17..287 1355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1344616..1344886 17..287 1355 100 Plus
X 23542271 X 4698295..4698459 123..287 450 84.8 Plus
X 23542271 X 4691737..4691845 17..125 305 85.3 Plus
Blast to na_te.dros performed on 2014-11-27 20:02:46 has no hits.

BS11196.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:48:01 Download gff for BS11196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RB 1..270 17..286 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:36:01 Download gff for BS11196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 126..418 7..299 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:06:06 Download gff for BS11196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 156..423 17..284 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:48:01 Download gff for BS11196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 126..418 7..299 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:13:26 Download gff for BS11196.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 156..423 17..284 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:13:26 Download gff for BS11196.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1344616..1344883 17..284 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:06:06 Download gff for BS11196.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1344616..1344883 17..284 100   Plus

BS11196.pep Sequence

Translation from 16 to 285

> BS11196.pep
MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKY
NPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG*

BS11196.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-PC 89 CG5450-PC 1..89 1..89 472 100 Plus
Cdlc2-PB 89 CG5450-PB 1..89 1..89 472 100 Plus
Cdlc2-PA 89 CG5450-PA 1..89 1..89 472 100 Plus
ctp-PE 89 CG6998-PE 1..89 1..89 469 98.9 Plus
ctp-PC 89 CG6998-PC 1..89 1..89 469 98.9 Plus