Clone Sequence Records
BS11303.3prime Sequence
375 bp (374 high quality bases) assembled on 2006-04-18
> BS11303.3prime
ATGGTCTAGAAAGCTTCTACTTCCTGTTCTGGTTGTTGCGGGCCATGTCC
TTGGGGAAGGAACGCAGTGGCGGCGTGCGGATGCGGCGGGCCTCGCGCGA
ACGGTTGCGCACCACCTTGGAGTGGATTGCGCAGGACACGCAGTAGTGGA
GCTTCGCATAGAGCTTGGGCAGCACGTACGAGTCCCAGATGCTGGCCTCC
GTGATGTCGCGCACGGCGGCAGCCTCCACGATGTTGCGGATGACGAACTT
CTTGATTGCCTTGTCCTTGGGCACGCAGCGGGCGCAGTTGGTGCAGCGCA
CGGGCTTCACATGGCCGCGATTGTGCTTGTTGCGTCCTCCGTTACGGCGC
TTCTTGGTCATGTCGACTGATAACT
BS11303.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:06:12
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG10305-PA | 345 | RpS26-RA | 1..345 | 361..17 | 1725 | 100 | Minus |
| CG10305-PB | 345 | RpS26-RB | 1..345 | 361..17 | 1725 | 100 | Minus |
| CG10305-PC | 345 | RpS26-RC | 1..345 | 361..17 | 1725 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:52:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS26-RD | 1046 | CG10305-RD | 85..430 | 361..16 | 1730 | 100 | Minus |
| RpS26-RE | 1812 | CG10305-RE | 85..430 | 361..16 | 1730 | 100 | Minus |
| RpS26-RA | 640 | CG10305-RA | 85..430 | 361..16 | 1730 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 12:52:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 18442717..18443062 | 16..361 | 1730 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 12:52:39 has no hits.
BS11303.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:04:55 Download gff for
BS11303.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS26-PB | 1..345 | 17..361 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:34:00 Download gff for
BS11303.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG10305-PC | 1..345 | 17..361 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 10:32:31 Download gff for
BS11303.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS26-RC | 85..436 | 9..361 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 14:19:36 Download gff for
BS11303.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS26-RA | 85..436 | 9..361 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 14:19:36 Download gff for
BS11303.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 18442711..18443062 | 9..361 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 10:32:31 Download gff for
BS11303.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 18442711..18443062 | 9..361 | 99 | | Plus |
BS11303.5prime Sequence
375 bp (374 high quality bases) assembled on 2006-04-18
> BS11303.5prime
GAAGTTATCAGTCGACATGACCAAGAAGCGCCGTAACGGAGGACGCAACA
AGCACAATCGCGGCCATGTGAAGCCCGTGCGCTGCACCAACTGCGCCCGC
TGCGTGCCCAAGGACAAGGCAATCAAGAAGTTCGTCATCCGCAACATCGT
GGAGGCTGCCGCCGTGCGCGACATCACGGAGGCCAGCATCTGGGACTCGT
ACGTGCTGCCCAAGCTCTATGCGAAGCTCCACTACTGCGTGTCCTGCGCA
ATCCACTCCAAGGTGGTGCGCAACCGTTCGCGCGAGGCCCGCCGCATCCG
CACGCCGCCACTGCGTTCCTTCCCCAAGGACATGGCCCGCAACAACCAGA
ACAGGAAGTAGAAGCTTTCTAGACC
BS11303.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:06:13
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG10305-PA | 345 | RpS26-RA | 1..345 | 17..361 | 1725 | 100 | Plus |
| CG10305-PB | 345 | RpS26-RB | 1..345 | 17..361 | 1725 | 100 | Plus |
| CG10305-PC | 345 | RpS26-RC | 1..345 | 17..361 | 1725 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:00:57
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS26-RD | 1046 | CG10305-RD | 85..430 | 17..362 | 1730 | 100 | Plus |
| RpS26-RE | 1812 | CG10305-RE | 85..430 | 17..362 | 1730 | 100 | Plus |
| RpS26-RA | 640 | CG10305-RA | 85..430 | 17..362 | 1730 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 12:00:54
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 18442717..18443062 | 362..17 | 1730 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-11 12:00:56 has no hits.
BS11303.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:04:56 Download gff for
BS11303.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS26-PB | 1..345 | 17..361 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:34:02 Download gff for
BS11303.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG10305-PC | 1..345 | 17..361 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 20:35:50 Download gff for
BS11303.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS26-RC | 85..436 | 17..369 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 13:34:19 Download gff for
BS11303.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS26-RA | 85..436 | 17..369 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 13:34:19 Download gff for
BS11303.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 18442711..18443062 | 17..369 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 20:35:50 Download gff for
BS11303.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 18442711..18443062 | 17..369 | 99 | | Minus |
BS11303.complete Sequence
377 bp assembled on 2006-11-01
GenBank Submission: FJ636813
> BS11303.complete
GAAGTTATCAGTCGACATGACCAAGAAGCGCCGTAACGGAGGACGCAACA
AGCACAATCGCGGCCATGTGAAGCCCGTGCGCTGCACCAACTGCGCCCGC
TGCGTGCCCAAGGACAAGGCAATCAAGAAGTTCGTCATCCGCAACATCGT
GGAGGCTGCCGCCGTGCGCGACATCACGGAGGCCAGCATCTGGGACTCGT
ACGTGCTGCCCAAGCTCTATGCGAAGCTCCACTACTGCGTGTCCTGCGCA
ATCCACTCCAAGGTGGTGCGCAACCGTTCGCGCGAGGCCCGCCGCATCCG
CACGCCGCCACTGCGTTCCTTCCCCAAGGACATGGCCCGCAACAACCAGA
ACAGGAAGTAGAAGCTTTCTAGACCAT
BS11303.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:21:03
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS26-RD | 345 | CG10305-PD | 1..345 | 17..361 | 1725 | 100 | Plus |
| RpS26-RE | 345 | CG10305-PE | 1..345 | 17..361 | 1725 | 100 | Plus |
| RpS26-RA | 345 | CG10305-PA | 1..345 | 17..361 | 1725 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:21:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS26-RD | 1046 | CG10305-RD | 85..430 | 17..362 | 1730 | 100 | Plus |
| RpS26-RE | 1812 | CG10305-RE | 85..430 | 17..362 | 1730 | 100 | Plus |
| RpS26-RA | 640 | CG10305-RA | 85..430 | 17..362 | 1730 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:21:01
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 18442717..18443062 | 362..17 | 1730 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 00:21:02 has no hits.
BS11303.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:47:57 Download gff for
BS11303.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS26-RC | 1..345 | 17..361 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:35:58 Download gff for
BS11303.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS26-RB | 97..448 | 17..369 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:22:51 Download gff for
BS11303.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS26-RC | 85..429 | 17..361 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:47:57 Download gff for
BS11303.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS26-RB | 97..448 | 17..369 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:30:19 Download gff for
BS11303.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS26-RA | 85..429 | 17..361 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:30:19 Download gff for
BS11303.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 18442718..18443062 | 17..361 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:22:51 Download gff for
BS11303.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 18442718..18443062 | 17..361 | 100 | | Minus |
BS11303.pep Sequence
Translation from 16 to 360
> BS11303.pep
MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAV
RDITEASIWDSYVLPKLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR
SFPKDMARNNQNRK*
BS11303.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:31:58
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS26-PD | 114 | CG10305-PD | 1..114 | 1..114 | 607 | 100 | Plus |
| RpS26-PE | 114 | CG10305-PE | 1..114 | 1..114 | 607 | 100 | Plus |
| RpS26-PA | 114 | CG10305-PA | 1..114 | 1..114 | 607 | 100 | Plus |
| RpS26-PC | 114 | CG10305-PC | 1..114 | 1..114 | 607 | 100 | Plus |
| RpS26-PB | 114 | CG10305-PB | 1..114 | 1..114 | 607 | 100 | Plus |
