Clone Sequence Records
BS11366.3prime Sequence
336 bp (335 high quality bases) assembled on 2006-04-18
> BS11366.3prime
ATGGTCTAGAAAGCTTTTAACACCGAAGCCTTTCAATACTTACCAGATTG
GTAAAATGGAAGCCACCTTTCCAAATGTTGGTCTTGGCGTTACCTGGCGT
CGTCGATTGGGTGATGGATGGCGTTGGCTTGGCCAGTACAGCGGGCGTGG
AAGCCACCGTGGGCTTAATCAGCTTACTCAACTTCGAGGGTGGTCCAATG
GGCACCCGGACGGTGACCTTCTTCTTCGGATTCAGCTGCAATTGGGTCTG
GTGGTAGGTATATTCGATGTCCTTCGCCGGGGACAAGGATTGCAGCCGAG
GCAGATCCTCTAAGTCGATCATGTCGACTGATAACT
BS11366.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:07:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13826-PA | 306 | CG13826-RA | 1..306 | 322..17 | 1530 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:20:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cnc-RN | 4746 | CG43286-RN | 313..592 | 322..43 | 1400 | 100 | Minus |
cnc-RM | 4737 | CG43286-RM | 304..583 | 322..43 | 1400 | 100 | Minus |
cnc-RI | 4750 | CG43286-RI | 317..596 | 322..43 | 1400 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 19:20:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23222770..23223075 | 17..322 | 1530 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 19:20:16 has no hits.
BS11366.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:06:54 Download gff for
BS11366.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-PA | 1..306 | 17..322 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:36:40 Download gff for
BS11366.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-PA | 1..306 | 17..322 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 04:26:56 Download gff for
BS11366.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 312..603 | 33..330 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:46:31 Download gff for
BS11366.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 312..603 | 33..330 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:46:31 Download gff for
BS11366.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23222763..23223080 | 10..330 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 04:26:56 Download gff for
BS11366.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19048485..19048802 | 10..330 | 97 | | Plus |
BS11366.5prime Sequence
336 bp (335 high quality bases) assembled on 2006-04-18
> BS11366.5prime
GAAGTTATCAGTCGACATGATCGACTTAGAGGATCTGCCTCGGCTGCAAT
CCTTGTCCCCGGCGAAGGACATCGAATATACCTACCACCAGACCCAATTG
CAGCTGAATCCGAAGAAGAAGGTCACCGTCCGGGTGCCCATTGGACCACC
CTCGAAGTTGAGTAAGCTGATTAAGCCCACGGTGGCTTCCACGCCCGCTG
TACTGGCCAAGCCAACGCCATCCATCACCCAATCGACGACGCCAGGTAAC
GCCAAGACCAACATTTGGAAAGGTGGCTTCCATTTTACCAATCTGGTAAG
TATTGAAAGGCTTCGGTGTTAAAAGCTTTCTAGACC
BS11366.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:07:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13826-PA | 306 | CG13826-RA | 1..306 | 17..322 | 1530 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:08:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cnc-RN | 4746 | CG43286-RN | 313..592 | 17..296 | 1400 | 100 | Plus |
cnc-RM | 4737 | CG43286-RM | 304..583 | 17..296 | 1400 | 100 | Plus |
cnc-RI | 4750 | CG43286-RI | 317..596 | 17..296 | 1400 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 20:08:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23222770..23223075 | 322..17 | 1530 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 20:08:16 has no hits.
BS11366.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:06:55 Download gff for
BS11366.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-PA | 1..306 | 17..322 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:36:41 Download gff for
BS11366.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-PA | 1..306 | 17..322 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 11:56:05 Download gff for
BS11366.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 312..603 | 9..306 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:45:34 Download gff for
BS11366.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 312..603 | 9..306 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 01:45:34 Download gff for
BS11366.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23222763..23223080 | 9..329 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 11:56:05 Download gff for
BS11366.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19048485..19048802 | 9..329 | 97 | | Minus |
BS11366.complete Sequence
338 bp assembled on 2006-11-01
GenBank Submission: FJ636839
> BS11366.complete
GAAGTTATCAGTCGACATGATCGACTTAGAGGATCTGCCTCGGCTGCAAT
CCTTGTCCCCGGCGAAGGACATCGAATATACCTACCACCAGACCCAATTG
CAGCTGAATCCGAAGAAGAAGGTCACCGTCCGGGTGCCCATTGGACCACC
CTCGAAGTTGAGTAAGCTGATTAAGCCCACGGTGGCTTCCACGCCCGCTG
TACTGGCCAAGCCAACGCCATCCATCACCCAATCGACGACGCCAGGTAAC
GCCAAGACCAACATTTGGAAAGGTGGCTTCCATTTTACCAATCTGGTAAG
TATTGAAAGGCTTCGGTGTTAAAAGCTTTCTAGACCAT
BS11366.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:27:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cnc-RN | 3402 | CG43286-PN | 1..280 | 17..296 | 1400 | 100 | Plus |
cnc-RM | 3402 | CG43286-PM | 1..280 | 17..296 | 1400 | 100 | Plus |
cnc-RI | 3402 | CG43286-PI | 1..280 | 17..296 | 1400 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:28:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cnc-RN | 4746 | CG43286-RN | 313..592 | 17..296 | 1400 | 100 | Plus |
cnc-RM | 4737 | CG43286-RM | 304..583 | 17..296 | 1400 | 100 | Plus |
cnc-RI | 4750 | CG43286-RI | 317..596 | 17..296 | 1400 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:27:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23222770..23223075 | 322..17 | 1530 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 08:27:58 has no hits.
BS11366.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:51:23 Download gff for
BS11366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-RA | 1..306 | 17..322 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:26:34 Download gff for
BS11366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-RA | 309..626 | 9..329 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:10:49 Download gff for
BS11366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 317..603 | 17..306 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:51:23 Download gff for
BS11366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-RA | 309..626 | 9..329 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:19:25 Download gff for
BS11366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 317..603 | 17..306 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:19:25 Download gff for
BS11366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23222772..23223075 | 17..320 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:10:49 Download gff for
BS11366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19048494..19048797 | 17..320 | 100 | | Minus |
BS11366.pep Sequence
Translation from 16 to 321
> BS11366.pep
MIDLEDLPRLQSLSPAKDIEYTYHQTQLQLNPKKKVTVRVPIGPPSKLSK
LIKPTVASTPAVLAKPTPSITQSTTPGNAKTNIWKGGFHFTNLVSIERLR
C*
BS11366.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:42:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cnc-PN | 1133 | CG43286-PN | 1..95 | 1..95 | 485 | 98.9 | Plus |
cnc-PM | 1133 | CG43286-PM | 1..95 | 1..95 | 485 | 98.9 | Plus |
cnc-PI | 1133 | CG43286-PI | 1..95 | 1..95 | 485 | 98.9 | Plus |