Clone BS11453 Report

Search the DGRC for BS11453

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:114
Well:53
Vector:pDNR-Dual
Associated Gene/Transcriptblp-RA
Protein status:BS11453.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11453.5prime Sequence

456 bp (455 high quality bases) assembled on 2006-05-08

> BS11453.5prime
GAAGTTATCAGTCGACATGGCCAAGTATATCGCCCAGATCATCGTGTTGG
GCGCCCAGGCAGTGGGAAGAGCCTTTACCAAGGCGCTGCGCCAGGAGATC
GCCGCATCTCAGGAAGCAGCACGACGGGCGGGTGGTGGCAAGCAGGGCGA
CAAGAGCGCCGAGTCCAACCTGCGCACAGGCATGACGCTGGAGGAAGCCA
AGCAGATCCTGAATATAGATGACCCCAAAAACGTGGACGCTATCACCAAG
AACTACGAGCATCTGTTTCAAGTCAACGAACGCTCCAAAGGCGGCTCCTT
CTATATCCAGTCAAAGGTTTTCCGGGCGAAAGAGCGGCTGGACCATGAGA
TTAAGGCCCATGAGCAGCCGAGGTCGTCAAATACGGAAGCAGCGCAAGAT
ACGGCGGAGGAGTCTCAGAGCAGATCGCGGCAGCGACGCTGAAAGCTTTC
TAGACC

BS11453.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG5268-PA 426 blp-RA 1..426 17..442 2130 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 03:12:50
Subject Length Description Subject Range Query Range Score Percent Strand
blp-RB 964 CG5268-RB 235..661 16..442 2135 100 Plus
blp-RA 955 CG5268-RA 226..652 16..442 2135 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 03:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15934372..15934637 177..442 1330 100 Plus
3R 32079331 3R 15934151..15934315 16..180 825 100 Plus
Blast to na_te.dros performed on 2015-02-04 03:12:46 has no hits.

BS11453.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:09:41 Download gff for BS11453.5prime
Subject Subject Range Query Range Percent Splice Strand
blp-PA 1..426 17..442 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:40:25 Download gff for BS11453.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5268-PA 1..426 17..442 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 20:51:29 Download gff for BS11453.5prime
Subject Subject Range Query Range Percent Splice Strand
blp-RA 235..669 13..450 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 04:27:34 Download gff for BS11453.5prime
Subject Subject Range Query Range Percent Splice Strand
blp-RA 223..657 13..450 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 04:27:34 Download gff for BS11453.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 15934148..15934314 13..179 99 -> Plus
3R 15934375..15934642 180..450 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 20:51:29 Download gff for BS11453.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11759870..11760036 13..179 99 -> Plus
arm_3R 11760097..11760364 180..450 98   Plus

BS11453.3prime Sequence

456 bp (455 high quality bases) assembled on 2006-05-08

> BS11453.3prime
ATGGTCTAGAAAGCTTTCAGCGTCGCTGCCGCGATCTGCTCTGAGACTCC
TCCGCCGTATCTTGCGCTGCTTCCGTATTTGACGACCTCGGCTGCTCATG
GGCCTTAATCTCATGGTCCAGCCGCTCTTTCGCCCGGAAAACCTTTGACT
GGATATAGAAGGAGCCGCCTTTGGAGCGTTCGTTGACTTGAAACAGATGC
TCGTAGTTCTTGGTGATAGCGTCCACGTTTTTGGGGTCATCTATATTCAG
GATCTGCTTGGCTTCCTCCAGCGTCATGCCTGTGCGCAGGTTGGACTCGG
CGCTCTTGTCGCCCTGCTTGCCACCACCCGCCCGTCGTGCTGCTTCCTGA
GATGCGGCGATCTCCTGGCGCAGCGCCTTGGTAAAGGCTCTTCCCACTGC
CTGGGCGCCCAACACGATGATCTGGGCGATATACTTGGCCATGTCGACTG
ATAACT

BS11453.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5268-PA 426 blp-RA 1..426 442..17 2130 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
blp-RB 964 CG5268-RB 235..661 443..17 2135 100 Minus
blp-RA 955 CG5268-RA 226..652 443..17 2135 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15934372..15934637 282..17 1330 100 Minus
3R 32079331 3R 15934151..15934315 443..279 825 100 Minus
Blast to na_te.dros performed on 2015-02-10 15:41:41 has no hits.

BS11453.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:09:40 Download gff for BS11453.3prime
Subject Subject Range Query Range Percent Splice Strand
blp-PA 1..426 17..442 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:40:23 Download gff for BS11453.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5268-PA 1..426 17..442 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 21:33:15 Download gff for BS11453.3prime
Subject Subject Range Query Range Percent Splice Strand
blp-RA 235..669 9..446 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:53:58 Download gff for BS11453.3prime
Subject Subject Range Query Range Percent Splice Strand
blp-RA 223..657 9..446 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 17:53:58 Download gff for BS11453.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 15934375..15934642 9..279 98   Minus
3R 15934148..15934314 280..446 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 21:33:15 Download gff for BS11453.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11759870..11760036 280..446 99 -> Minus
arm_3R 11760097..11760364 9..279 98   Minus

BS11453.complete Sequence

458 bp assembled on 2006-11-01

GenBank Submission: FJ636872

> BS11453.complete
GAAGTTATCAGTCGACATGGCCAAGTATATCGCCCAGATCATCGTGTTGG
GCGCCCAGGCAGTGGGAAGAGCCTTTACCAAGGCGCTGCGCCAGGAGATC
GCCGCATCTCAGGAAGCAGCACGACGGGCGGGTGGTGGCAAGCAGGGCGA
CAAGAGCGCCGAGTCCAACCTGCGCACAGGCATGACGCTGGAGGAAGCCA
AGCAGATCCTGAATATAGATGACCCCAAAAACGTGGACGCTATCACCAAG
AACTACGAGCATCTGTTTCAAGTCAACGAACGCTCCAAAGGCGGCTCCTT
CTATATCCAGTCAAAGGTTTTCCGGGCGAAAGAGCGGCTGGACCATGAGA
TTAAGGCCCATGAGCAGCCGAGGTCGTCAAATACGGAAGCAGCGCAAGAT
ACGGCGGAGGAGTCTCAGAGCAGATCGCGGCAGCGACGCTGAAAGCTTTC
TAGACCAT

BS11453.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
blp-RB 426 CG5268-PB 1..426 17..442 2130 100 Plus
blp-RA 426 CG5268-PA 1..426 17..442 2130 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
blp-RB 964 CG5268-RB 235..661 16..442 2135 100 Plus
blp-RA 955 CG5268-RA 226..652 16..442 2135 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15934372..15934637 177..442 1330 100 Plus
3R 32079331 3R 15934151..15934315 16..180 825 100 Plus
Blast to na_te.dros performed on 2014-11-27 20:32:45 has no hits.

BS11453.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:50:43 Download gff for BS11453.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 1..426 17..442 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:25:49 Download gff for BS11453.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 218..652 13..450 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:11:18 Download gff for BS11453.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 239..663 17..441 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:50:43 Download gff for BS11453.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 218..652 13..450 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:23:29 Download gff for BS11453.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 227..651 17..441 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:23:29 Download gff for BS11453.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15934152..15934314 17..179 100 -> Plus
3R 15934375..15934636 180..441 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:11:18 Download gff for BS11453.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11759874..11760036 17..179 100 -> Plus
arm_3R 11760097..11760358 180..441 100   Plus

BS11453.pep Sequence

Translation from 16 to 441

> BS11453.pep
MAKYIAQIIVLGAQAVGRAFTKALRQEIAASQEAARRAGGGKQGDKSAES
NLRTGMTLEEAKQILNIDDPKNVDAITKNYEHLFQVNERSKGGSFYIQSK
VFRAKERLDHEIKAHEQPRSSNTEAAQDTAEESQSRSRQRR*

BS11453.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:43:49
Subject Length Description Subject Range Query Range Score Percent Strand
blp-PB 141 CG5268-PB 1..141 1..141 698 100 Plus
blp-PA 141 CG5268-PA 1..141 1..141 698 100 Plus
CG1409-PB 150 CG1409-PB 1..117 1..116 305 55.6 Plus