Clone BS11604 Report

Search the DGRC for BS11604

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:116
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptRpS25-RA
Protein status:BS11604.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11604.3prime Sequence

384 bp (384 high quality bases) assembled on 2006-06-16

> BS11604.3prime
ATGGTCTAGAAAGCTTTTACGCCTCATCACCCTTGGTGGCACGTGTGTAG
ATGACCTGGGAATGATGCTGCACGACCTGCTTGATCAGACCCTTCTCGCG
CAGCTCGATGAGAGCACGCTTGGCCAGGGAGCCGCGGATCTTCAGACGCT
CGGAGACCACCGATGGGGTGATCAGCTTGTAGGCGGGCACTTCCTTGTAC
AGCTTCTCGTAGGTGGCCTTGTCGAACAGCACCTGGTTGTTCAGCTTGTC
CCTGACTTTTCCCTTGGACCACTTCTTCTTCTTGGCCTTGCCGCCGCCGG
ATCCCTCCTTCTTCTTTTGTGTCTTTTGCGGCTGCTTGGCCGAAGACTTC
GCGTCCTTCTTAGGCGGCATGTCGACTGATAACT

BS11604.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6684-PA 354 RpS25-RA 1..354 370..17 1770 100 Minus
CG6684-PB 354 RpS25-RB 1..354 370..17 1770 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
RpS25-RB 515 CG6684-RB 27..381 370..16 1775 100 Minus
RpS25-RA 850 CG6684-RA 27..381 370..16 1775 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11215691..11215970 89..368 1400 100 Plus
3R 32079331 3R 11215550..11215625 16..91 380 100 Plus
Blast to na_te.dros performed on 2015-02-06 10:35:12 has no hits.

BS11604.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:28:34 Download gff for BS11604.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6684-PB 1..354 17..370 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:43:13 Download gff for BS11604.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS25-RA 22..381 16..379 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:27:33 Download gff for BS11604.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS25-RA 22..381 16..379 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:27:33 Download gff for BS11604.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 11215550..11215624 16..90 100 <- Plus
3R 11215693..11215977 91..378 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:43:13 Download gff for BS11604.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7041272..7041346 16..90 100 <- Plus
arm_3R 7041415..7041699 91..378 98   Plus

BS11604.5prime Sequence

384 bp (384 high quality bases) assembled on 2006-06-16

> BS11604.5prime
GAAGTTATCAGTCGACATGCCGCCTAAGAAGGACGCGAAGTCTTCGGCCA
AGCAGCCGCAAAAGACACAAAAGAAGAAGGAGGGATCCGGCGGCGGCAAG
GCCAAGAAGAAGAAGTGGTCCAAGGGAAAAGTCAGGGACAAGCTGAACAA
CCAGGTGCTGTTCGACAAGGCCACCTACGAGAAGCTGTACAAGGAAGTGC
CCGCCTACAAGCTGATCACCCCATCGGTGGTCTCCGAGCGTCTGAAGATC
CGCGGCTCCCTGGCCAAGCGTGCTCTCATCGAGCTGCGCGAGAAGGGTCT
GATCAAGCAGGTCGTGCAGCATCATTCCCAGGTCATCTACACACGTGCCA
CCAAGGGTGATGAGGCGTAAAAGCTTTCTAGACC

BS11604.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG6684-PA 354 RpS25-RA 1..354 17..370 1770 100 Plus
CG6684-PB 354 RpS25-RB 1..354 17..370 1770 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
RpS25-RB 515 CG6684-RB 27..381 17..371 1775 100 Plus
RpS25-RA 850 CG6684-RA 27..381 17..371 1775 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11215691..11215970 298..19 1400 100 Minus
3R 32079331 3R 11215550..11215625 371..296 380 100 Minus
Blast to na_te.dros performed on 2015-02-10 17:15:02 has no hits.

BS11604.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:28:34 Download gff for BS11604.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6684-PB 1..354 17..370 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:24:11 Download gff for BS11604.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS25-RA 22..381 8..371 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:08:11 Download gff for BS11604.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS25-RA 22..381 8..371 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:08:11 Download gff for BS11604.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 11215550..11215624 297..371 100 <- Minus
3R 11215693..11215977 9..296 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:24:11 Download gff for BS11604.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7041272..7041346 297..371 100 <- Minus
arm_3R 7041415..7041699 9..296 98   Minus

BS11604.complete Sequence

386 bp assembled on 2006-11-01

GenBank Submission: FJ636914

> BS11604.complete
GAAGTTATCAGTCGACATGCCGCCTAAGAAGGACGCGAAGTCTTCGGCCA
AGCAGCCGCAAAAGACACAAAAGAAGAAGGAGGGATCCGGCGGCGGCAAG
GCCAAGAAGAAGAAGTGGTCCAAGGGAAAAGTCAGGGACAAGCTGAACAA
CCAGGTGCTGTTCGACAAGGCCACCTACGAGAAGCTGTACAAGGAAGTGC
CCGCCTACAAGCTGATCACCCCATCGGTGGTCTCCGAGCGTCTGAAGATC
CGCGGCTCCCTGGCCAAGCGTGCTCTCATCGAGCTGCGCGAGAAGGGTCT
GATCAAGCAGGTCGTGCAGCATCATTCCCAGGTCATCTACACACGTGCCA
CCAAGGGTGATGAGGCGTAAAAGCTTTCTAGACCAT

BS11604.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
RpS25-RB 354 CG6684-PB 1..354 17..370 1770 100 Plus
RpS25-RA 354 CG6684-PA 1..354 17..370 1770 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
RpS25-RB 515 CG6684-RB 27..381 17..371 1775 100 Plus
RpS25-RA 850 CG6684-RA 27..381 17..371 1775 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11215691..11215970 298..19 1400 100 Minus
3R 32079331 3R 11215550..11215625 371..296 380 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:24:25 has no hits.

BS11604.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:49:59 Download gff for BS11604.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RB 1..354 17..370 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:55:13 Download gff for BS11604.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RA 50..409 8..371 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:09:40 Download gff for BS11604.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RA 27..378 17..368 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:49:59 Download gff for BS11604.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RA 50..409 8..371 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:20:47 Download gff for BS11604.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RA 27..378 17..368 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:20:47 Download gff for BS11604.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11215553..11215624 297..368 100 <- Minus
3R 11215693..11215971 17..296 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:09:40 Download gff for BS11604.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7041275..7041346 297..368 100 <- Minus
arm_3R 7041415..7041693 17..296 99   Minus

BS11604.pep Sequence

Translation from 16 to 369

> BS11604.pep
MPPKKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFD
KATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVV
QHHSQVIYTRATKGDEA*

BS11604.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
RpS25-PB 117 CG6684-PB 1..117 1..117 591 100 Plus
RpS25-PA 117 CG6684-PA 1..117 1..117 591 100 Plus