Clone BS11631 Report

Search the DGRC for BS11631

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:116
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG9921-RB
Protein status:BS11631.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11631.5prime Sequence

339 bp (339 high quality bases) assembled on 2006-06-16

> BS11631.5prime
GAAGTTATCAGTCGACATGTCGAACAAAATTGAAGTCTCGCTTCCGGAGG
AGGAACTGGATTGGATACAATTGCGCCAGGACCTGGGACCCGTTGCCGAG
GTGGAAACGACCAAGGAGAAGTTGCAGCGCAAGATCAAGGAGAATCCGCT
GGTTCCGTTGGGATGTTTGGCCACTACAGCGGCGCTCACAGCTGGCTTAT
ACAACTTTCGCACTGGCAATCGCAAGATGTCGCAGCTGATGATGCGAAGT
CGTATCGCGGCTCAGGGATTTACCGTTATGGCCCTAGTTGTCGGCGTCGT
CATGACCTACACTGATAAAAAATAAAAGCTTTCTAGACC

BS11631.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-PA 309 CG9921-RA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 10:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-RC 985 CG9921-RC 392..704 13..325 1550 99.7 Plus
CG9921-RB 685 CG9921-RB 92..404 13..325 1550 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 10:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16331562..16331726 325..161 825 100 Minus
X 23542271 X 16331808..16331957 162..13 735 99.3 Minus
Blast to na_te.dros performed on 2015-01-31 10:19:55 has no hits.

BS11631.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:28:41 Download gff for BS11631.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-PA 1..309 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:36:54 Download gff for BS11631.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 86..406 6..330 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:45:56 Download gff for BS11631.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 86..406 6..330 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:45:56 Download gff for BS11631.5prime
Subject Subject Range Query Range Percent Splice Strand
X 16331560..16331725 162..330 98 <- Minus
X 16331809..16331963 6..161 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:36:54 Download gff for BS11631.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 16225593..16225758 162..330 98 <- Minus
arm_X 16225842..16225996 6..161 97   Minus

BS11631.3prime Sequence

339 bp (339 high quality bases) assembled on 2006-06-16

> BS11631.3prime
ATGGTCTAGAAAGCTTTTATTTTTTATCAGTGTAGGTCATGACGACGCCG
ACAACTAGGGCCATAACGGTAAATCCCTGAGCCGCGATACGACTTCGCAT
CATCAGCTGCGACATCTTGCGATTGCCAGTGCGAAAGTTGTATAAGCCAG
CTGTGAGCGCCGCTGTAGTGGCCAAACATCCCAACGGAACCAGCGGATTC
TCCTTGATCTTGCGCTGCAACTTCTCCTTGGTCGTTTCCACCTCGGCAAC
GGGTCCCAGGTCCTGGCGCAATTGTATCCAATCCAGTTCCTCCTCCGGAA
GCGAGACTTCAATTTTGTTCGACATGTCGACTGATAACT

BS11631.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-PA 309 CG9921-RA 1..309 325..17 1545 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-RC 985 CG9921-RC 392..704 329..17 1550 99.7 Minus
CG9921-RB 685 CG9921-RB 92..404 329..17 1550 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16331562..16331726 17..181 825 100 Plus
X 23542271 X 16331808..16331957 180..329 735 99.3 Plus
Blast to na_te.dros performed on 2015-02-08 12:11:57 has no hits.

BS11631.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:28:40 Download gff for BS11631.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-PA 1..309 17..325 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:40:40 Download gff for BS11631.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 86..406 12..336 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:45:18 Download gff for BS11631.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 86..406 12..336 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:45:18 Download gff for BS11631.3prime
Subject Subject Range Query Range Percent Splice Strand
X 16331560..16331725 12..180 98 <- Plus
X 16331809..16331963 181..336 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:40:40 Download gff for BS11631.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 16225593..16225758 12..180 98 <- Plus
arm_X 16225842..16225996 181..336 97   Plus

BS11631.complete Sequence

341 bp assembled on 2006-11-01

GenBank Submission: FJ636920

> BS11631.complete
GAAGTTATCAGTCGACATGTCGAACAAAATTGAAGTCTCGCTTCCGGAGG
AGGAACTGGATTGGATACAATTGCGCCAGGACCTGGGACCCGTTGCCGAG
GTGGAAACGACCAAGGAGAAGTTGCAGCGCAAGATCAAGGAGAATCCGCT
GGTTCCGTTGGGATGTTTGGCCACTACAGCGGCGCTCACAGCTGGCTTAT
ACAACTTTCGCACTGGCAATCGCAAGATGTCGCAGCTGATGATGCGAAGT
CGTATCGCGGCTCAGGGATTTACCGTTATGGCCCTAGTTGTCGGCGTCGT
CATGACCTACACTGATAAAAAATAAAAGCTTTCTAGACCAT

BS11631.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-RC 309 CG9921-PC 1..309 17..325 1545 100 Plus
CG9921-RB 309 CG9921-PB 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-RC 985 CG9921-RC 392..704 13..325 1550 99.7 Plus
CG9921-RB 685 CG9921-RB 92..404 13..325 1550 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16331562..16331726 325..161 825 100 Minus
X 23542271 X 16331808..16331957 162..13 735 99.3 Minus
Blast to na_te.dros performed on 2014-11-28 00:23:02 has no hits.

BS11631.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:49:50 Download gff for BS11631.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 1..309 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:55:11 Download gff for BS11631.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 186..506 6..330 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:51:09 Download gff for BS11631.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 96..393 17..314 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:49:50 Download gff for BS11631.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 186..506 6..330 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:19:30 Download gff for BS11631.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 96..393 17..314 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:19:30 Download gff for BS11631.complete
Subject Subject Range Query Range Percent Splice Strand
X 16331573..16331725 162..314 100 <- Minus
X 16331809..16331953 17..161 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:51:09 Download gff for BS11631.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16225606..16225758 162..314 100 <- Minus
arm_X 16225842..16225986 17..161 100   Minus

BS11631.pep Sequence

Translation from 16 to 324

> BS11631.pep
MSNKIEVSLPEEELDWIQLRQDLGPVAEVETTKEKLQRKIKENPLVPLGC
LATTAALTAGLYNFRTGNRKMSQLMMRSRIAAQGFTVMALVVGVVMTYTD
KK*

BS11631.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-PC 102 CG9921-PC 1..102 1..102 510 100 Plus
CG9921-PB 102 CG9921-PB 1..102 1..102 510 100 Plus