Clone BS11796 Report

Search the DGRC for BS11796

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:117
Well:96
Vector:pDNR-Dual
Associated Gene/Transcriptl(2)06225-RA
Protein status:BS11796.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11796.3prime Sequence

330 bp (330 high quality bases) assembled on 2006-06-16

> BS11796.3prime
ATGGTCTAGAAAGCTTTTAGACATTGTAGCCTACAATGTGACGCTTGCCG
ATGCACTCGCCGATGTAGAACCAGAAGATGACCTCGGCGGTCACCAGGGT
GTTAAGCCAGGCCTCGCGAACCGTGAGGTTCTTGTAGGCGCCGGTCTTGG
CTCCCTTGATGATGTTGCCCAGTCCTTGGCGAATGGCCGGAATATCGGCG
GGCGTCGGGGGCGTCAGTTCCACCTTGGCGTACTTCAGGAACACGTCCAG
TTGGGGCCTCGCCTGTGTGAGGAGCCTGTTCACAAGTCCTGATCCCTTGG
TAGCCAAACTCGCCATGTCGACTGATAACT

BS11796.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6105-PA 300 l(2)06225-RA 1..300 316..17 1500 100 Minus
CG6105-PB 300 l(2)06225-RB 1..300 316..17 1500 100 Minus
CG6105-PC 300 l(2)06225-RC 1..300 316..17 1500 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-RD 733 CG6105-RD 54..353 316..17 1500 100 Minus
l(2)06225-RB 477 CG6105-RB 54..353 316..17 1500 100 Minus
l(2)06225-RA 497 CG6105-RA 74..373 316..17 1500 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10975902..10976161 17..276 1300 100 Plus
2L 23513712 2L 10976250..10976290 276..316 205 100 Plus
Blast to na_te.dros performed on 2015-02-06 10:10:45 has no hits.

BS11796.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:29:29 Download gff for BS11796.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6105-PC 1..300 17..316 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:38:51 Download gff for BS11796.3prime
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..381 7..316 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:24:20 Download gff for BS11796.3prime
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..381 7..316 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:24:20 Download gff for BS11796.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 10976251..10976290 277..316 100   Plus
2L 10975894..10976161 7..276 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:38:51 Download gff for BS11796.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10975894..10976161 7..276 98 <- Plus
arm_2L 10976251..10976290 277..316 100   Plus

BS11796.5prime Sequence

330 bp (330 high quality bases) assembled on 2006-06-16

> BS11796.5prime
GAAGTTATCAGTCGACATGGCGAGTTTGGCTACCAAGGGATCAGGACTTG
TGAACAGGCTCCTCACACAGGCGAGGCCCCAACTGGACGTGTTCCTGAAG
TACGCCAAGGTGGAACTGACGCCCCCGACGCCCGCCGATATTCCGGCCAT
TCGCCAAGGACTGGGCAACATCATCAAGGGAGCCAAGACCGGCGCCTACA
AGAACCTCACGGTTCGCGAGGCCTGGCTTAACACCCTGGTGACCGCCGAG
GTCATCTTCTGGTTCTACATCGGCGAGTGCATCGGCAAGCGTCACATTGT
AGGCTACAATGTCTAAAAGCTTTCTAGACC

BS11796.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6105-PA 300 l(2)06225-RA 1..300 17..316 1500 100 Plus
CG6105-PB 300 l(2)06225-RB 1..300 17..316 1500 100 Plus
CG6105-PC 300 l(2)06225-RC 1..300 17..316 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 11:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-RD 733 CG6105-RD 54..353 17..316 1500 100 Plus
l(2)06225-RB 477 CG6105-RB 54..353 17..316 1500 100 Plus
l(2)06225-RA 497 CG6105-RA 74..373 17..316 1500 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 11:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10975902..10976161 316..57 1300 100 Minus
2L 23513712 2L 10976250..10976290 57..17 205 100 Minus
Blast to na_te.dros performed on 2015-02-08 11:39:13 has no hits.

BS11796.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:29:29 Download gff for BS11796.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6105-PC 1..300 17..316 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:35:48 Download gff for BS11796.5prime
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..381 17..326 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:41:15 Download gff for BS11796.5prime
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..381 17..326 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:41:15 Download gff for BS11796.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 10975894..10976161 57..326 98 <- Minus
2L 10976251..10976290 17..56 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:35:48 Download gff for BS11796.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10975894..10976161 57..326 98 <- Minus
arm_2L 10976251..10976290 17..56 100   Minus

BS11796.complete Sequence

332 bp assembled on 2006-11-01

GenBank Submission: FJ636975

> BS11796.complete
GAAGTTATCAGTCGACATGGCGAGTTTGGCTACCAAGGGATCAGGACTTG
TGAACAGGCTCCTCACACAGGCGAGGCCCCAACTGGACGTGTTCCTGAAG
TACGCCAAGGTGGAACTGACGCCCCCGACGCCCGCCGATATTCCGGCCAT
TCGCCAAGGACTGGGCAACATCATCAAGGGAGCCAAGACCGGCGCCTACA
AGAACCTCACGGTTCGCGAGGCCTGGCTTAACACCCTGGTGACCGCCGAG
GTCATCTTCTGGTTCTACATCGGCGAGTGCATCGGCAAGCGTCACATTGT
AGGCTACAATGTCTAAAAGCTTTCTAGACCAT

BS11796.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-RD 300 CG6105-PD 1..300 17..316 1500 100 Plus
l(2)06225-RB 300 CG6105-PB 1..300 17..316 1500 100 Plus
l(2)06225-RA 300 CG6105-PA 1..300 17..316 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-RD 733 CG6105-RD 54..353 17..316 1500 100 Plus
l(2)06225-RB 477 CG6105-RB 54..353 17..316 1500 100 Plus
l(2)06225-RA 497 CG6105-RA 74..373 17..316 1500 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10975902..10976161 316..57 1300 100 Minus
2L 23513712 2L 10976250..10976290 57..17 205 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:56:44 has no hits.

BS11796.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:48:58 Download gff for BS11796.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 1..300 17..316 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:23:43 Download gff for BS11796.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 434..741 17..326 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:48 Download gff for BS11796.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..371 17..314 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:48:58 Download gff for BS11796.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 434..741 17..326 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:58:44 Download gff for BS11796.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..371 17..314 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:58:44 Download gff for BS11796.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10975904..10976161 57..314 100 <- Minus
2L 10976251..10976290 17..56 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:48 Download gff for BS11796.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10975904..10976161 57..314 100 <- Minus
arm_2L 10976251..10976290 17..56 100   Minus

BS11796.pep Sequence

Translation from 16 to 315

> BS11796.pep
MASLATKGSGLVNRLLTQARPQLDVFLKYAKVELTPPTPADIPAIRQGLG
NIIKGAKTGAYKNLTVREAWLNTLVTAEVIFWFYIGECIGKRHIVGYNV*

BS11796.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-PD 99 CG6105-PD 1..99 1..99 512 100 Plus
l(2)06225-PB 99 CG6105-PB 1..99 1..99 512 100 Plus
l(2)06225-PA 99 CG6105-PA 1..99 1..99 512 100 Plus
CG7211-PA 107 CG7211-PA 1..107 1..99 261 51.4 Plus