Clone BS12032 Report

Search the DGRC for BS12032

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:120
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG14229-RA
Protein status:BS12032.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12032.3prime Sequence

351 bp (351 high quality bases) assembled on 2006-06-16

> BS12032.3prime
ATGGTCTAGAAAGCTTCTACTGGCTGCTCCGCTTGATGCGCTCGACATGC
AGGTCGTACAGCATCTTGTTCTTCTCGTAGTAAAATGGGTTTTGTTCGGC
TCCCAGTTCTGGGTTGTATTCGTATCCGGCCGCCACACCGTTTCCGGCTG
CATCGGACCCGCCGGATCCACCAGTCGCTCCTCCTCCCGACAGTGGCGGA
ATGCTGCAGCTGCTGCTGCTGCTGCTGTTCCCATCCTCGTAGTTCAGATT
CAGGTTGTTGATGCGCTTCGAAAGGGGCGACTCGCAGGCCAGTTCATCCT
CCCGGCTGCGCTTTCTTGTCTTCAGGAATCCAGCCATGTCGACTGATAAC
T

BS12032.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-PA 321 CG14229-RA 1..321 337..17 1605 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-RB 1018 CG14229-RB 108..428 337..17 1605 100 Minus
CG14229-RC 989 CG14229-RC 300..620 337..17 1605 100 Minus
CG14229-RA 797 CG14229-RA 108..428 337..17 1605 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19694567..19694866 17..316 1500 100 Plus
Blast to na_te.dros performed on 2015-02-11 09:06:48 has no hits.

BS12032.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:30:38 Download gff for BS12032.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-PA 1..321 17..337 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:00:08 Download gff for BS12032.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 102..428 17..347 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:51:52 Download gff for BS12032.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 102..428 17..347 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 10:51:52 Download gff for BS12032.3prime
Subject Subject Range Query Range Percent Splice Strand
X 19694567..19694864 17..314 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:00:08 Download gff for BS12032.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19588600..19588897 17..314 100 <- Plus

BS12032.5prime Sequence

351 bp (351 high quality bases) assembled on 2006-06-16

> BS12032.5prime
GAAGTTATCAGTCGACATGGCTGGATTCCTGAAGACAAGAAAGCGCAGCC
GGGAGGATGAACTGGCCTGCGAGTCGCCCCTTTCGAAGCGCATCAACAAC
CTGAATCTGAACTACGAGGATGGGAACAGCAGCAGCAGCAGCAGCTGCAG
CATTCCGCCACTGTCGGGAGGAGGAGCGACTGGTGGATCCGGCGGGTCCG
ATGCAGCCGGAAACGGTGTGGCGGCCGGATACGAATACAACCCAGAACTG
GGAGCCGAACAAAACCCATTTTACTACGAGAAGAACAAGATGCTGTACGA
CCTGCATGTCGAGCGCATCAAGCGGAGCAGCCAGTAGAAGCTTTCTAGAC
C

BS12032.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-PA 321 CG14229-RA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-RB 1018 CG14229-RB 108..428 17..337 1605 100 Plus
CG14229-RC 989 CG14229-RC 300..620 17..337 1605 100 Plus
CG14229-RA 797 CG14229-RA 108..428 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19694567..19694866 337..38 1500 100 Minus
Blast to na_te.dros performed on 2015-02-12 03:50:10 has no hits.

BS12032.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:30:38 Download gff for BS12032.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-PA 1..321 17..337 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:30:31 Download gff for BS12032.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 102..428 7..337 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:56:05 Download gff for BS12032.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 102..428 7..337 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:56:05 Download gff for BS12032.5prime
Subject Subject Range Query Range Percent Splice Strand
X 19694567..19694864 40..337 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:30:31 Download gff for BS12032.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19588600..19588897 40..337 100 <- Minus

BS12032.complete Sequence

353 bp assembled on 2006-11-01

GenBank Submission: FJ638840

> BS12032.complete
GAAGTTATCAGTCGACATGGCTGGATTCCTGAAGACAAGAAAGCGCAGCC
GGGAGGATGAACTGGCCTGCGAGTCGCCCCTTTCGAAGCGCATCAACAAC
CTGAATCTGAACTACGAGGATGGGAACAGCAGCAGCAGCAGCAGCTGCAG
CATTCCGCCACTGTCGGGAGGAGGAGCGACTGGTGGATCCGGCGGGTCCG
ATGCAGCCGGAAACGGTGTGGCGGCCGGATACGAATACAACCCAGAACTG
GGAGCCGAACAAAACCCATTTTACTACGAGAAGAACAAGATGCTGTACGA
CCTGCATGTCGAGCGCATCAAGCGGAGCAGCCAGTAGAAGCTTTCTAGAC
CAT

BS12032.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-RB 321 CG14229-PB 1..321 17..337 1605 100 Plus
CG14229-RC 321 CG14229-PC 1..321 17..337 1605 100 Plus
CG14229-RA 321 CG14229-PA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-RB 1018 CG14229-RB 108..428 17..337 1605 100 Plus
CG14229-RC 989 CG14229-RC 300..620 17..337 1605 100 Plus
CG14229-RA 797 CG14229-RA 108..428 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19694567..19694866 337..38 1500 100 Minus
Blast to na_te.dros performed on 2014-11-27 14:47:34 has no hits.

BS12032.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:03 Download gff for BS12032.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 1..321 17..337 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:11:07 Download gff for BS12032.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 85..411 7..337 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:55 Download gff for BS12032.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 108..428 17..337 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:03 Download gff for BS12032.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 85..411 7..337 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:18:45 Download gff for BS12032.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 108..428 17..337 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:18:45 Download gff for BS12032.complete
Subject Subject Range Query Range Percent Splice Strand
X 19694567..19694864 40..337 100 <- Minus
X 19694929..19694951 17..39 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:55 Download gff for BS12032.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19588600..19588897 40..337 100 <- Minus
arm_X 19588962..19588984 17..39 100   Minus

BS12032.pep Sequence

Translation from 16 to 336

> BS12032.pep
MAGFLKTRKRSREDELACESPLSKRINNLNLNYEDGNSSSSSSCSIPPLS
GGGATGGSGGSDAAGNGVAAGYEYNPELGAEQNPFYYEKNKMLYDLHVER
IKRSSQ*

BS12032.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-PB 106 CG14229-PB 1..106 1..106 554 100 Plus
CG14229-PC 106 CG14229-PC 1..106 1..106 554 100 Plus
CG14229-PA 106 CG14229-PA 1..106 1..106 554 100 Plus