Clone BS12048 Report

Search the DGRC for BS12048

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:120
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptLcp65Ac-RA
Protein status:BS12048.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12048.5prime Sequence

360 bp (360 high quality bases) assembled on 2006-06-16

> BS12048.5prime
GAAGTTATCAGTCGACATGAAGTGCACAGTTGCCATCGTCTTCACCGCTC
TCTTCGCCGTCGTTCTGGCTGCCCCCGCTCCCGATGCGGATACCCAGATC
CTGCGTCTGGAGTCCGACGTCCAGCCGGAGGGCTACAACTTTGCTTTGGA
GACCAGCGACGGCAAGAAGCACGAGGAGCAGGGTCAGCTCAAGAACGTCG
GCACCGAACAGGAGGCCATCGTGGTCCGCGGATCCTACTCCTTCGTGGCC
GATGATGGCCAGACCTACACGGTCAACTACATCGCTGACGAGAACGGATT
CCAGCCCGAGGGTGCCCATCTGCCCAATGTGCCCATCGGCAACTAAAAGC
TTTCTAGACC

BS12048.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG6956-PA 330 Lcp65Ac-RA 1..330 17..346 1650 100 Plus
CG10529-PA 300 Lcp65Ae-RA 235..284 272..321 175 94 Plus
CG18779-PA 318 CG18779-RA 247..300 272..325 170 92.5 Plus
CG6955-PA 327 Lcp65Ad-RA 277..313 290..326 160 97.2 Plus
CG10533-PA 303 Lcp65Af-RA 247..285 287..325 145 94.8 Plus
CG10530-PA 318 Lcp65Ag1-RA 247..300 272..325 145 90.7 Plus
CG10534-PA 318 Lcp65Ag2-RA 247..300 272..325 145 90.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ac-RA 505 CG6956-RA 91..422 15..346 1660 100 Plus
Lcp65Ad-RB 616 CG6955-RB 176..387 115..326 400 79.8 Plus
Lcp65Ad-RA 521 CG6955-RA 176..387 115..326 400 79.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6145109..6145310 145..346 1010 100 Plus
3L 28110227 3L 6144909..6145038 15..144 650 100 Plus
3L 28110227 3L 6143693..6143872 147..326 330 78.9 Plus
3L 28110227 3L 6137731..6137854 325..202 320 83.9 Minus
3L 28110227 3L 6130569..6130664 325..230 300 87.5 Minus
3L 28110227 3L 6147581..6147730 325..176 300 80 Minus
3L 28110227 3L 6150452..6150601 325..176 300 80 Minus
3L 28110227 3L 6133172..6133267 325..230 285 86.5 Minus
3L 28110227 3L 6134853..6134948 325..230 285 86.5 Minus
3L 28110227 3L 6136398..6136538 325..185 285 80.1 Minus
3L 28110227 3L 6139425..6139576 325..174 205 75.7 Minus
3L 28110227 3L 6152285..6152358 327..254 190 83.8 Minus
Blast to na_te.dros performed on 2015-02-06 10:13:24 has no hits.

BS12048.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:30:43 Download gff for BS12048.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6956-PA 1..330 17..346 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:39:14 Download gff for BS12048.5prime
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ac-RA 91..424 15..350 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:24:41 Download gff for BS12048.5prime
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ac-RA 91..424 15..350 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:24:41 Download gff for BS12048.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 6144909..6145038 15..144 100 -> Plus
3L 6145109..6145312 145..350 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:39:14 Download gff for BS12048.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6138009..6138138 15..144 100 -> Plus
arm_3L 6138209..6138412 145..350 99   Plus

BS12048.3prime Sequence

360 bp (360 high quality bases) assembled on 2006-06-16

> BS12048.3prime
ATGGTCTAGAAAGCTTTTAGTTGCCGATGGGCACATTGGGCAGATGGGCA
CCCTCGGGCTGGAATCCGTTCTCGTCAGCGATGTAGTTGACCGTGTAGGT
CTGGCCATCATCGGCCACGAAGGAGTAGGATCCGCGGACCACGATGGCCT
CCTGTTCGGTGCCGACGTTCTTGAGCTGACCCTGCTCCTCGTGCTTCTTG
CCGTCGCTGGTCTCCAAAGCAAAGTTGTAGCCCTCCGGCTGGACGTCGGA
CTCCAGACGCAGGATCTGGGTATCCGCATCGGGAGCGGGGGCAGCCAGAA
CGACGGCGAAGAGAGCGGTGAAGACGATGGCAACTGTGCACTTCATGTCG
ACTGATAACT

BS12048.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6956-PA 330 Lcp65Ac-RA 1..330 346..17 1650 100 Minus
CG10529-PA 300 Lcp65Ae-RA 235..284 91..42 175 94 Minus
CG18779-PA 318 CG18779-RA 247..300 91..38 170 92.5 Minus
CG6955-PA 327 Lcp65Ad-RA 277..313 73..37 160 97.2 Minus
CG10533-PA 303 Lcp65Af-RA 247..285 76..38 145 94.8 Minus
CG10530-PA 318 Lcp65Ag1-RA 247..300 91..38 145 90.7 Minus
CG10534-PA 318 Lcp65Ag2-RA 247..300 91..38 145 90.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ac-RA 505 CG6956-RA 91..422 348..17 1660 100 Minus
Lcp65Ad-RB 616 CG6955-RB 176..387 248..37 400 79.8 Minus
Lcp65Ad-RA 521 CG6955-RA 176..387 248..37 400 79.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6145109..6145310 218..17 1010 100 Minus
3L 28110227 3L 6144909..6145038 348..219 650 100 Minus
3L 28110227 3L 6143693..6143872 216..37 330 78.9 Minus
3L 28110227 3L 6137731..6137854 38..161 320 83.9 Plus
3L 28110227 3L 6130569..6130664 38..133 300 87.5 Plus
3L 28110227 3L 6147581..6147730 38..187 300 80 Plus
3L 28110227 3L 6150452..6150601 38..187 300 80 Plus
3L 28110227 3L 6133172..6133267 38..133 285 86.5 Plus
3L 28110227 3L 6134853..6134948 38..133 285 86.5 Plus
3L 28110227 3L 6136398..6136538 38..178 285 80.1 Plus
3L 28110227 3L 6139425..6139576 38..189 205 75.7 Plus
3L 28110227 3L 6152285..6152358 36..109 190 83.8 Plus
Blast to na_te.dros performed on 2015-02-06 10:13:11 has no hits.

BS12048.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:30:42 Download gff for BS12048.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6956-PA 1..330 17..346 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:39:12 Download gff for BS12048.3prime
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ac-RA 91..424 13..348 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:24:39 Download gff for BS12048.3prime
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ac-RA 91..424 13..348 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:24:39 Download gff for BS12048.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 6144909..6145038 219..348 100 -> Minus
3L 6145109..6145312 13..218 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:39:12 Download gff for BS12048.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6138009..6138138 219..348 100 -> Minus
arm_3L 6138209..6138412 13..218 99   Minus

BS12048.complete Sequence

362 bp assembled on 2006-11-01

GenBank Submission: FJ637047

> BS12048.complete
GAAGTTATCAGTCGACATGAAGTGCACAGTTGCCATCGTCTTCACCGCTC
TCTTCGCCGTCGTTCTGGCTGCCCCCGCTCCCGATGCGGATACCCAGATC
CTGCGTCTGGAGTCCGACGTCCAGCCGGAGGGCTACAACTTTGCTTTGGA
GACCAGCGACGGCAAGAAGCACGAGGAGCAGGGTCAGCTCAAGAACGTCG
GCACCGAACAGGAGGCCATCGTGGTCCGCGGATCCTACTCCTTCGTGGCC
GATGATGGCCAGACCTACACGGTCAACTACATCGCTGACGAGAACGGATT
CCAGCCCGAGGGTGCCCATCTGCCCAATGTGCCCATCGGCAACTAAAAGC
TTTCTAGACCAT

BS12048.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ac-RA 330 CG6956-PA 1..330 17..346 1650 100 Plus
Lcp65Ad-RB 327 CG6955-PB 102..313 115..326 400 79.2 Plus
Lcp65Ad-RA 327 CG6955-PA 102..313 115..326 400 79.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ac-RA 505 CG6956-RA 91..422 15..346 1660 100 Plus
Lcp65Ad-RB 616 CG6955-RB 176..387 115..326 400 79.2 Plus
Lcp65Ad-RA 521 CG6955-RA 176..387 115..326 400 79.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6145109..6145310 145..346 1010 100 Plus
3L 28110227 3L 6144909..6145038 15..144 650 100 Plus
3L 28110227 3L 6143693..6143872 147..326 330 78.9 Plus
3L 28110227 3L 6137731..6137854 325..202 320 83.9 Minus
3L 28110227 3L 6130569..6130664 325..230 300 87.5 Minus
3L 28110227 3L 6147581..6147730 325..176 300 80 Minus
3L 28110227 3L 6150452..6150601 325..176 300 80 Minus
3L 28110227 3L 6133172..6133267 325..230 285 86.5 Minus
3L 28110227 3L 6134853..6134948 325..230 285 86.5 Minus
3L 28110227 3L 6136398..6136538 325..185 285 80.1 Minus
3L 28110227 3L 6139425..6139576 325..174 205 75.7 Minus
3L 28110227 3L 6152285..6152358 327..254 190 83.8 Minus
Blast to na_te.dros performed on 2014-11-27 15:58:10 has no hits.

BS12048.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:38:38 Download gff for BS12048.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ac-RA 1..330 17..346 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:16:36 Download gff for BS12048.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ac-RA 86..419 15..350 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:46:47 Download gff for BS12048.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ac-RA 93..420 17..344 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:38:38 Download gff for BS12048.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ac-RA 86..419 15..350 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:07:07 Download gff for BS12048.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ac-RA 93..420 17..344 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:07:07 Download gff for BS12048.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6144911..6145038 17..144 100 -> Plus
3L 6145109..6145308 145..344 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:46:47 Download gff for BS12048.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6138011..6138138 17..144 100 -> Plus
arm_3L 6138209..6138408 145..344 100   Plus

BS12048.pep Sequence

Translation from 16 to 345

> BS12048.pep
MKCTVAIVFTALFAVVLAAPAPDADTQILRLESDVQPEGYNFALETSDGK
KHEEQGQLKNVGTEQEAIVVRGSYSFVADDGQTYTVNYIADENGFQPEGA
HLPNVPIGN*

BS12048.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ac-PA 109 CG6956-PA 1..109 1..109 563 100 Plus
Lcp65Ad-PB 108 CG6955-PB 1..104 1..103 382 69.2 Plus
Lcp65Ad-PA 108 CG6955-PA 1..104 1..103 382 69.2 Plus
Lcp65Ag3-PA 105 CG18779-PA 5..104 7..107 328 65.3 Plus
Lcp65Ag1-PA 105 CG10530-PA 5..104 7..107 325 64.4 Plus