Clone BS12210 Report

Search the DGRC for BS12210

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:122
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG8993-RA
Protein status:BS12210.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12210.complete Sequence

461 bp assembled on 2006-11-01

GenBank Submission: FJ637097

> BS12210.complete
GAAGTTATCAGTCGACATGCAGCGACAGATTATTAACATTCTGGGACAGA
CGACGCGTCGCCTGGCTAGCGGCCAGCAAATTCGCATGCTGTCAGTTTCT
GCGCCGCGACAGGAGATCTTCAAAGTCCAGAGCGCCGAGGACTTTGACAA
GAAAGTAAAGAACAGCCAGCAGCCCGTGATTGTGGACTTCTTCGCAACCT
GGTGCAATCCCTGCAAGCTGCTAACCCCGCGCATCGAGAGTATTGTGGGC
GAACAGGCCGGTTCCATCAAGCTGGCCAAGGTGGACATAGATGAGCACAG
CGAACTGGCTCTGGACTACGATGTGGCCGCCGTGCCCGTGCTAGTGGTGC
TGCAGAACGGCAAGGAGGTGCAGCGCATGGTGGGACTCCAGGACGAGGAC
AAAATCCGGGCCTGGGTTGCCGCCGCCGTCAAACAGGCCAAGTAAAAGCT
TTCTAGACCAT

BS12210.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG8993-RA 429 CG8993-PA 1..429 17..445 2145 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8993-RA 616 CG8993-RA 83..512 16..445 2150 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2372526..2372772 199..445 1235 100 Plus
3L 28110227 3L 2372281..2372463 16..198 915 100 Plus
Blast to na_te.dros performed on 2014-11-27 19:44:56 has no hits.

BS12210.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:47:27 Download gff for BS12210.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 1..429 17..445 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:35:23 Download gff for BS12210.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 77..517 7..451 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:02:50 Download gff for BS12210.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 84..510 17..443 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:47:27 Download gff for BS12210.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 77..517 7..451 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:07:35 Download gff for BS12210.complete
Subject Subject Range Query Range Percent Splice Strand
CG8993-RA 84..510 17..443 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:07:35 Download gff for BS12210.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2372282..2372463 17..198 100 -> Plus
3L 2372526..2372770 199..443 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:02:50 Download gff for BS12210.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2372526..2372770 199..443 100   Plus
arm_3L 2372282..2372463 17..198 100 -> Plus

BS12210.pep Sequence

Translation from 16 to 444

> BS12210.pep
MQRQIINILGQTTRRLASGQQIRMLSVSAPRQEIFKVQSAEDFDKKVKNS
QQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSELALD
YDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAAAVKQAK*

BS12210.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG8993-PA 142 CG8993-PA 1..142 1..142 708 100 Plus
CG8517-PA 145 CG8517-PA 11..135 14..138 347 52 Plus
CG3719-PA 160 CG3719-PA 34..149 17..134 208 36.4 Plus
Trx-2-PA 106 CG31884-PA 2..104 34..132 197 35 Plus
Trx-2-PB 106 CG31884-PB 2..104 34..132 197 35 Plus