Clone BS12217 Report

Search the DGRC for BS12217

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:122
Well:17
Vector:pDNR-Dual
Associated Gene/TranscriptCisd2-RA
Protein status:BS12217.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12217.complete Sequence

434 bp assembled on 2006-11-01

GenBank Submission: FJ637100

> BS12217.complete
GAAGTTATCAGTCGACATGGAGCCCATATCACATCTGGTGAAGTCCTCGC
TGCCCAATTACTTGTCAAGTCTGCCGGTTCCCGACAGCATCGGCGGCTGG
TTTAAGCTCTCCTTCAAGGATTGGTTGGCCCTGATCCCACCCACCGTGGT
GGTGGCCGGACTCGGCTACACCGCCTACCTGGCCTACTGTCCGGCGGCAC
GGGCCAGCTGCGCGGCCAAAAACAGCGGACGCTGCAACAACCACATCCGC
AAGAACGAGCCCAAGGTGGTGGACATGATCGACGTGGAGGATATTGCGGA
GAAGGCGGCCTTCTGTCGCTGCTGGAAGACCAAGAACTGGCCCTACTGCG
ATGGCAGTCATGGCGAGCACAACAAGCAGACTGGAGACAACGTCGGACCA
ATTGTCATCAAGAAGTAGAAGCTTTCTAGACCAT

BS12217.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
Cisd2-RA 402 CG1458-PA 1..402 17..418 2010 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
Cisd2-RA 675 CG1458-RA 85..492 12..419 2025 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29222546..29222769 337..114 1120 100 Minus
3R 32079331 3R 29223243..29223344 113..12 495 99 Minus
3R 32079331 3R 29222400..29222481 419..338 410 100 Minus
Blast to na_te.dros performed on 2014-11-27 12:50:30 has no hits.

BS12217.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:46:01 Download gff for BS12217.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 1..402 17..418 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:21:01 Download gff for BS12217.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 84..491 12..419 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:46:26 Download gff for BS12217.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 90..491 17..418 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:46:02 Download gff for BS12217.complete
Subject Subject Range Query Range Percent Splice Strand
CG1458-RA 84..491 12..419 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:05:53 Download gff for BS12217.complete
Subject Subject Range Query Range Percent Splice Strand
Cisd2-RA 90..491 17..418 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:05:53 Download gff for BS12217.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29222546..29222769 114..337 100 <- Minus
3R 29223243..29223339 17..113 100   Minus
3R 29222401..29222481 338..418 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:46:26 Download gff for BS12217.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25048123..25048203 338..418 100 <- Minus
arm_3R 25048268..25048491 114..337 100 <- Minus
arm_3R 25048965..25049061 17..113 100   Minus

BS12217.pep Sequence

Translation from 16 to 417

> BS12217.pep
MEPISHLVKSSLPNYLSSLPVPDSIGGWFKLSFKDWLALIPPTVVVAGLG
YTAYLAYCPAARASCAAKNSGRCNNHIRKNEPKVVDMIDVEDIAEKAAFC
RCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIKK*

BS12217.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:37
Subject Length Description Subject Range Query Range Score Percent Strand
Cisd2-PA 133 CG1458-PA 1..133 1..133 733 100 Plus