Clone BS12264 Report

Search the DGRC for BS12264

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:122
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptSNCF-RA
Protein status:BS12264.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12264.complete Sequence

473 bp assembled on 2006-11-01

GenBank Submission: FJ637120

> BS12264.complete
GAAGTTATCAGTCGACATGATTGACCAGCACAAGCGCAGCCACAAATCAG
AGAAATCCAGTCGCAAGTCGGGAAAGAAACATTCCGACAAACCACACAAG
GTGAAGACCCACGATCCGCTCAAGAAACAAAAGAAGCGGGCTCTAAAGAA
GCTCCGCCGCAAGTCCGCCACCGTGAATTTCCCGTACCAACTCTTCTTGT
ACCGCCAAGAACTAAGGCGGGCCAGCGCCGACTTTTCCTATCTCCGGCTG
TCCAAGGCCAAGATAGTGCTTACCTCCCAACTAATCGCCAAGAAGATGGG
CAGCTGCAATCCCGATTGCAGCGTGGACGAGCTTAAGGAACTCAGCCGCG
AGGTGCAGTTCCAGAAACGCCTCTGCCATCAAGTGGAGCGCCTGCAGCAA
TTCCGGCAACTGGGACTCACCGAGATGATCCTCAACGGCAAGAAGACGAC
GCTGTAAAAGCTTTCTAGACCAT

BS12264.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
SNCF-RA 441 CG14112-PA 1..441 17..457 2205 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
SNCF-RA 608 CG14112-RA 39..480 16..457 2210 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13378621..13379062 16..457 2210 100 Plus
Blast to na_te.dros performed 2014-11-27 20:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 2765..2820 43..98 109 66.1 Plus

BS12264.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:45:50 Download gff for BS12264.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 1..441 17..457 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:20:47 Download gff for BS12264.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 32..481 9..462 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:05:01 Download gff for BS12264.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 40..478 17..455 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:45:51 Download gff for BS12264.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 32..481 9..462 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:17:26 Download gff for BS12264.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 40..478 17..455 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:17:26 Download gff for BS12264.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13378622..13379060 17..455 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:05:01 Download gff for BS12264.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13371722..13372160 17..455 100   Plus

BS12264.pep Sequence

Translation from 16 to 456

> BS12264.pep
MIDQHKRSHKSEKSSRKSGKKHSDKPHKVKTHDPLKKQKKRALKKLRRKS
ATVNFPYQLFLYRQELRRASADFSYLRLSKAKIVLTSQLIAKKMGSCNPD
CSVDELKELSREVQFQKRLCHQVERLQQFRQLGLTEMILNGKKTTL*

BS12264.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
SNCF-PA 146 CG14112-PA 1..146 1..146 744 100 Plus
CG13711-PA 127 CG13711-PA 31..115 47..134 150 37.5 Plus