Clone BS12270 Report

Search the DGRC for BS12270

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:122
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptCG7713-RA
Protein status:BS12270.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12270.complete Sequence

542 bp assembled on 2006-11-01

GenBank Submission: FJ637124

> BS12270.complete
GAAGTTATCAGTCGACATGGTAGTGCTGAGCTCCTGCTGGTCGCCCATAA
TTTGGTCGGATAATGTCCGGACGGGAAGCTATGCCGTGGCCGGCTATACG
GCTGCGCTATCCGCCGTAATGATCACGCTGATTTCGTATATGCTAGCAGG
CGGGGAGTCTGCGCAGCTCTATTCCCCGCTCTTTGAGACGGATATACGTT
CGTCGATGCCCGTGGCAGGTGGCTTCTTTATCATCTACTTCCTGCTAATC
ATCCTGTCTTCCTATTTGGTCTACTACGGTATTAAGATCAGCACTCGAGG
ATGGCTGCTACCCTGGCTGGGTCTAATTGGACTAGCCATTCTCTTCCAGT
TTAGCTGGAGCCTTTGGCTTATTGGAGGCTACTATATTTATCTGGAGCAA
ACCTTCTCGGCCCTTTTGAACTTCGTTTGGGTAGCCTACAATATCTATTG
CTGGCTGGTGGTCTTCTCGCAGTACCAGATATTCCTGGAGATCCAGAATC
CGAACATTGAGCTGCTCATGCCATGAAAGCTTTCTAGACCAT

BS12270.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG7713-RB 510 CG7713-PB 1..510 17..526 2550 100 Plus
CG7713-RA 510 CG7713-PA 1..510 17..526 2550 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG7713-RB 874 CG7713-RB 124..635 15..526 2560 100 Plus
CG7713-RA 816 CG7713-RA 66..577 15..526 2560 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17795363..17795639 15..291 1385 100 Plus
3R 32079331 3R 17795697..17795800 288..391 520 100 Plus
3R 32079331 3R 17795995..17796078 443..526 420 100 Plus
3R 32079331 3R 17795863..17795913 392..442 255 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:52:49 has no hits.

BS12270.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:45:39 Download gff for BS12270.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 1..510 17..526 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:20:33 Download gff for BS12270.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 71..586 10..526 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:01:30 Download gff for BS12270.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 77..585 17..525 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:45:40 Download gff for BS12270.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 71..586 10..526 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:28:18 Download gff for BS12270.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 68..576 17..525 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:28:18 Download gff for BS12270.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17795365..17795639 17..291 100 -> Plus
3R 17795701..17795800 292..391 100 -> Plus
3R 17795863..17795913 392..442 100 -> Plus
3R 17795995..17796077 443..525 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:01:30 Download gff for BS12270.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13621087..13621361 17..291 100 -> Plus
arm_3R 13621423..13621522 292..391 100 -> Plus
arm_3R 13621585..13621635 392..442 100 -> Plus
arm_3R 13621717..13621799 443..525 100   Plus

BS12270.pep Sequence

Translation from 16 to 525

> BS12270.pep
MVVLSSCWSPIIWSDNVRTGSYAVAGYTAALSAVMITLISYMLAGGESAQ
LYSPLFETDIRSSMPVAGGFFIIYFLLIILSSYLVYYGIKISTRGWLLPW
LGLIGLAILFQFSWSLWLIGGYYIYLEQTFSALLNFVWVAYNIYCWLVVF
SQYQIFLEIQNPNIELLMP*

BS12270.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG7713-PB 169 CG7713-PB 1..169 1..169 886 100 Plus
CG7713-PA 169 CG7713-PA 1..169 1..169 886 100 Plus