Clone BS12315 Report

Search the DGRC for BS12315

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:123
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptCG5500-RA
Protein status:BS12315.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12315.complete Sequence

536 bp assembled on 2006-11-01

GenBank Submission: FJ637139

> BS12315.complete
GAAGTTATCAGTCGACATGTTGGCTCCCCTGGGCTTCAGCTGTCCGCGAT
GCTTGCTCCTGCGACGTGGCGCCGAGCGTTGGGCCTCACTGGCCCGCCAA
TTGTCGGGCAGCAGCTCCCAGGATGATGCCAGCAGCAAGGATGCGGCCGC
CCAGGAGGCAGCAAGTGGCTGTCCGCCCAATAGCACAACGACGGGCACTG
ACACTCCCAAAGCCAAAGATAAAACCACCAAGGGAAGGAAGCGGCTCAGA
AACATAGAGATACCTCCCGAGCCCACCACCTGCTGCATGTCGGGCTGCGC
CAACTGCGTTTGGCTGGACTACGCACAGACGCTGGCCAAGCTGCTGGGCG
ACAACGATGAGGAGGCGCGAGAGATTGTGCTGAGCAAGATCACCGACCCG
AACCTGAAGATGTTCCTCAGCCTGGAGCTGCGCCAGATGGCTAAGCAGCG
GGAGGAGAAGGCGGCGGCGGAGAAAGCAGCGAAGCAGGGAAAGCCAAAGA
AATCCTCGCCCCCGCCGTAGAAGCTTTCTAGACCAT

BS12315.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG5500-RA 504 CG5500-PA 1..504 17..520 2520 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:45:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG5500-RA 859 CG5500-RA 242..745 17..520 2520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26880083..26880345 258..520 1315 100 Plus
3R 32079331 3R 26879594..26879836 17..259 1215 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:45:16 has no hits.

BS12315.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:45:21 Download gff for BS12315.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 1..504 17..520 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:20:09 Download gff for BS12315.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 228..742 7..520 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:43:40 Download gff for BS12315.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 247..745 22..520 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:45:21 Download gff for BS12315.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 228..742 7..520 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:57 Download gff for BS12315.complete
Subject Subject Range Query Range Percent Splice Strand
CG5500-RA 247..745 22..520 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:57 Download gff for BS12315.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26879599..26879836 22..259 100 -> Plus
3R 26880085..26880345 260..520 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:43:40 Download gff for BS12315.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22705321..22705558 22..259 100 -> Plus
arm_3R 22705807..22706067 260..520 100   Plus

BS12315.pep Sequence

Translation from 16 to 519

> BS12315.pep
MLAPLGFSCPRCLLLRRGAERWASLARQLSGSSSQDDASSKDAAAQEAAS
GCPPNSTTTGTDTPKAKDKTTKGRKRLRNIEIPPEPTTCCMSGCANCVWL
DYAQTLAKLLGDNDEEAREIVLSKITDPNLKMFLSLELRQMAKQREEKAA
AEKAAKQGKPKKSSPPP*

BS12315.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG5500-PA 167 CG5500-PA 1..167 1..167 869 100 Plus