Clone BS12341 Report

Search the DGRC for BS12341

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:123
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptCG7394-RA
Protein status:BS12341.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12341.complete Sequence

389 bp assembled on 2006-11-01

GenBank Submission: FJ637147

> BS12341.complete
GAAGTTATCAGTCGACATGGCGAGCTCCGTAATTCTGGCGGGTCTTAGCG
TGGCCGCCGTGGGATTCGCCGGAAAGCACCTGATGCGCCGCATGCCCCAG
ATGACCACCAAATTCAACGAGGCCCTCAAGAACCTGCCCAAATACGATGC
GGAGAGCATGGCCGCCTCCAAATACTACAAGGGCGGCTTCGATCCCAAGA
TGAACAAGCGGGAGGCGTCCCTAATCCTAGGTGTCAGCCCCAGTGCGTCC
AAGATAAAGATTAAGGACGCGCACAAGAAGATCATGCTGTTGAACCATCC
GGATCGAGGAGGATCTCCCTATTTGGCGGCCAAGATCAACGAGGCCAAAG
ACTTTCTGGACAAAGCGAAGTAGAAGCTTTCTAGACCAT

BS12341.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG7394-RC 357 CG7394-PC 1..357 17..373 1785 100 Plus
CG7394-RD 357 CG7394-PD 1..357 17..373 1785 100 Plus
CG7394-RA 357 CG7394-PA 1..357 17..373 1785 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG7394-RC 1315 CG7394-RC 63..419 17..373 1785 100 Plus
CG7394-RD 1431 CG7394-RD 179..535 17..373 1785 100 Plus
CG7394-RA 534 CG7394-RA 63..419 17..373 1785 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11562860..11563100 19..259 1205 100 Plus
3L 28110227 3L 11563301..11563416 258..373 580 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:56:18 has no hits.

BS12341.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:47:24 Download gff for BS12341.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 1..357 17..373 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:35:20 Download gff for BS12341.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 50..413 9..373 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:09 Download gff for BS12341.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 63..419 17..373 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:47:25 Download gff for BS12341.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 50..413 9..373 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:59:33 Download gff for BS12341.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 63..419 17..373 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:59:33 Download gff for BS12341.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11562858..11563100 17..259 99 -> Plus
3L 11563303..11563416 260..373 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:09 Download gff for BS12341.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11555958..11556200 17..259 99 -> Plus
arm_3L 11556403..11556516 260..373 100   Plus

BS12341.pep Sequence

Translation from 16 to 372

> BS12341.pep
MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAA
SKYYKGGFDPKMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGS
PYLAAKINEAKDFLDKAK*

BS12341.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG7394-PC 118 CG7394-PC 1..118 1..118 595 100 Plus
CG7394-PD 118 CG7394-PD 1..118 1..118 595 100 Plus
CG7394-PA 118 CG7394-PA 1..118 1..118 595 100 Plus
CG7394-PB 128 CG7394-PB 12..128 2..118 590 100 Plus
CG32727-PA 122 CG32727-PA 53..114 47..114 142 44.1 Plus