Clone BS12351 Report

Search the DGRC for BS12351

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:123
Well:51
Vector:pDNR-Dual
Associated Gene/TranscriptCG15887-RA
Protein status:BS12351.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12351.complete Sequence

446 bp assembled on 2006-11-01

> BS12351.complete
GAAGTTATCAGTCGACATGGCCGCCAACCAGAAGATTGTGTTCGCCCTCG
TCTGCCTCTTTTTGGCATGTGATTTGGTGCTGGGTCAGCAGCAGGCGGCC
AACAGCTCGGATTCGGATTCGGATGTGGCGGAAAGTCGTACTTTTGGCCA
TCATTTCCTGCGGCGCATCAGCTTCGCCTTGGTGCCCGGCGCCTTTGTCG
TGGGCGTGATCACCACCCTGCTGGCGGCCTTGACCGTCGTCTCCATCAAG
GGACTGGGCGTGGGTGTCATCCTGCTGGTGCTGGCCATCGGACAAATGCT
GTCCCGTGCTCTTCCCGTCCAGGCAGCCGCCGCCTATGCCGCAGCACCCG
TTCCCGTCCAGGCACCCGTGCCGGTGGTCTACTCCCACTCGCACACCCAG
CAGCCCGTCTGGTTGGAGAAGGAGTGGTAGAAGCTTTCTAGACCAT

BS12351.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15887-RA 414 CG15887-PA 1..414 17..430 2070 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15887-RA 863 CG15887-RA 103..522 12..431 2085 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13287996..13288296 431..131 1505 100 Minus
3R 32079331 3R 13288592..13288711 131..12 585 99.2 Minus
Blast to na_te.dros performed on 2014-11-27 15:37:52 has no hits.

BS12351.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:45:08 Download gff for BS12351.complete
Subject Subject Range Query Range Percent Splice Strand
CG15887-RA 1..414 17..430 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:19:52 Download gff for BS12351.complete
Subject Subject Range Query Range Percent Splice Strand
CG15887-RA 94..525 7..437 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:48:16 Download gff for BS12351.complete
Subject Subject Range Query Range Percent Splice Strand
CG15887-RA 108..521 17..430 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:45:08 Download gff for BS12351.complete
Subject Subject Range Query Range Percent Splice Strand
CG15887-RA 94..525 7..437 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:12:29 Download gff for BS12351.complete
Subject Subject Range Query Range Percent Splice Strand
CG15887-RA 108..521 17..430 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:12:29 Download gff for BS12351.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13287997..13288295 132..430 100 <- Minus
3R 13288592..13288706 17..131 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:48:16 Download gff for BS12351.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9113719..9114017 132..430 100 <- Minus
arm_3R 9114314..9114428 17..131 100   Minus

BS12351.pep Sequence

Translation from 16 to 429

> BS12351.pep
MAANQKIVFALVCLFLACDLVLGQQQAANSSDSDSDVAESRTFGHHFLRR
ISFALVPGAFVVGVITTLLAALTVVSIKGLGVGVILLVLAIGQMLSRALP
VQAAAAYAAAPVPVQAPVPVVYSHSHTQQPVWLEKEW*

BS12351.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 01:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG15887-PA 137 CG15887-PA 1..137 1..137 681 100 Plus