Clone BS12354 Report

Search the DGRC for BS12354

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:123
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptTpnC25D-RA
Protein status:BS12354.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12354.complete Sequence

482 bp assembled on 2006-11-01

GenBank Submission: FJ637148

> BS12354.complete
GAAGTTATCAGTCGACATGGAGGACGACGAGAAAATGGACATCATGCGCA
AGGCATTCCAAATGTTCGACACACAAAAGACGGGCTTCATTGAGACGCTG
CGTCTGAAGACGATCCTCAACAGCATGGGTCAGATGTTCGACGATAGCGA
ACTGCAGGCTCTGATCGACGACAACGATCCGGAGGACACCGGCAAGGTTA
ACTTCGACGGCTTCTGCAGCATCGCTGCCCATTTCCTGGAAGAGGAGGAT
GCCGAGGCCATCCAGAAGGAGCTGAAAGAGGCCTTTCGTCTGTACGATCG
CGAGGGAAATGGTTACATCACCACCTCAACGCTGAAGGAAATTCTCGCCG
CCCTCGACGACAAGCTCTCCTCCAGCGATCTGGACGGCATCATCGCTGAG
ATTGACACTGATGGATCCGGTACCGTGGACTTTGATGAATTCATGGAGAT
GATGGCGGGCGAGTAGAAGCTTTCTAGACCAT

BS12354.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:11:24
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC25D-RC 450 CG6514-PC 1..450 17..466 2250 100 Plus
TpnC25D-RA 450 CG6514-PA 1..450 17..466 2250 100 Plus
TpnC25D-RB 432 CG6514-PB 1..432 35..466 2160 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC25D-RC 1107 CG6514-RC 560..1011 17..468 2260 100 Plus
TpnC25D-RA 645 CG6514-RA 98..549 17..468 2260 100 Plus
TpnC25D-RB 688 CG6514-RB 142..592 18..468 2255 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5218446..5218864 19..437 2095 100 Plus
2R 25286936 2R 11274671..11274793 346..224 195 77.2 Minus
Blast to na_te.dros performed on 2014-11-28 00:11:22 has no hits.

BS12354.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:45:09 Download gff for BS12354.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 1..450 17..466 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:19:53 Download gff for BS12354.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 82..543 9..468 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:19:33 Download gff for BS12354.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 97..546 17..466 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:45:09 Download gff for BS12354.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 82..543 9..468 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:27:40 Download gff for BS12354.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 98..547 17..466 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:27:40 Download gff for BS12354.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5218445..5218864 17..437 99 -> Plus
2L 5218927..5218955 438..466 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:19:33 Download gff for BS12354.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5218445..5218864 17..437 99 -> Plus
arm_2L 5218927..5218955 438..466 100   Plus

BS12354.pep Sequence

Translation from 16 to 465

> BS12354.pep
MEDDEKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALI
DDNDPEDTGKVNFDGFCSIAAHFLEEEDAEAIQKELKEAFRLYDREGNGY
ITTSTLKEILAALDDKLSSSDLDGIIAEIDTDGSGTVDFDEFMEMMAGE*

BS12354.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC25D-PC 149 CG6514-PC 1..149 1..149 758 100 Plus
TpnC25D-PA 149 CG6514-PA 1..149 1..149 758 100 Plus
TpnC25D-PB 143 CG6514-PB 1..143 7..149 726 100 Plus
TpnC47D-PB 155 CG9073-PB 11..155 5..149 425 58.6 Plus
TpnC47D-PA 155 CG9073-PA 11..155 5..149 425 58.6 Plus