Clone BS12355 Report

Search the DGRC for BS12355

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:123
Well:55
Vector:pDNR-Dual
Associated Gene/TranscriptArf102F-RA
Protein status:BS12355.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12355.complete Sequence

575 bp assembled on 2006-11-01

GenBank Submission: FJ637149

> BS12355.complete
GAAGTTATCAGTCGACATGGGACTAACAATATCTAGTCTTTTGACACGTT
TGTTTGGAAAAAAACAAATGCGTATTCTTATGGTTGGCTTGGATGCTGCT
GGAAAAACGACTATTCTGTACAAATTAAAGCTGGGTGAAATTGTAACCAC
CATACCAACCATAGGCTTCAATGTCGAGACTGTGGAATATAAGAATATAT
GTTTTACCGTTTGGGATGTTGGTGGCCAAGACAAAATTCGCCCGTTGTGG
CGACACTATTTCCAAAATACACAGGGTCTTATATTTGTAGTGGATTCCAA
CGACCGCGATCGTATAACTGAAGCTGAAAGAGAACTACAGAACATGCTCC
AGGAGGATGAACTTAGGGACGCGGTACTTTTGGTTTTTGCCAACAAACAG
GACCTACCGAATGCAATGACAGCTGCCGAGCTTACGGACAAGTTGCGCCT
TAACCAATTAAGGAATCGCCACTGGTTTATTCAGTCTACATGTGCTACCC
AAGGGCACGGTCTTTATGAAGGACTTGATTGGCTATCAGCTGAATTGGCT
AAAAAATAAAAGCTTTCTAGACCAT

BS12355.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Arf102F-RB 543 CG11027-PB 1..543 17..559 2715 100 Plus
Arf102F-RA 543 CG11027-PA 1..543 17..559 2715 100 Plus
Arf79F-RJ 549 CG8385-PJ 64..299 80..315 520 81.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Arf102F-RB 718 CG11027-RB 97..643 15..561 2735 100 Plus
Arf102F-RA 930 CG11027-RA 97..643 15..561 2735 100 Plus
Arf79F-RJ 1464 CG8385-RJ 405..640 80..315 520 81.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 1124435..1124698 83..346 1320 100 Plus
4 1348131 4 1124767..1124893 346..472 635 100 Plus
4 1348131 4 1124950..1125038 473..561 445 100 Plus
4 1348131 4 1124263..1124331 15..83 345 100 Plus
3L 28110227 3L 22869666..22869777 273..162 305 84.8 Minus
Blast to na_te.dros performed on 2014-11-27 14:47:11 has no hits.

BS12355.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:45:10 Download gff for BS12355.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 1..543 17..559 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:19:55 Download gff for BS12355.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 90..642 15..567 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:45 Download gff for BS12355.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 99..632 17..550 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:45:11 Download gff for BS12355.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 90..642 15..567 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:18:35 Download gff for BS12355.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 99..632 17..550 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:18:35 Download gff for BS12355.complete
Subject Subject Range Query Range Percent Splice Strand
4 1124950..1125027 473..550 100   Plus
4 1124265..1124331 17..83 100 -> Plus
4 1124436..1124698 84..346 100 -> Plus
4 1124768..1124893 347..472 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:45 Download gff for BS12355.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 1145062..1145324 84..346 100 -> Plus
arm_4 1145394..1145519 347..472 100 -> Plus
arm_4 1145576..1145653 473..550 100   Plus
arm_4 1144891..1144957 17..83 100 -> Plus

BS12355.pep Sequence

Translation from 16 to 558

> BS12355.pep
MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG
FNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRI
TEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKLRLNQLRN
RHWFIQSTCATQGHGLYEGLDWLSAELAKK*

BS12355.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
Arf102F-PB 180 CG11027-PB 1..180 1..180 932 100 Plus
Arf102F-PA 180 CG11027-PA 1..180 1..180 932 100 Plus
Arf79F-PJ 182 CG8385-PJ 1..177 1..177 767 83.1 Plus
Arf79F-PI 182 CG8385-PI 1..177 1..177 767 83.1 Plus
Arf79F-PH 182 CG8385-PH 1..177 1..177 767 83.1 Plus