Clone BS12420 Report

Search the DGRC for BS12420

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:124
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptSmD3-RA
Protein status:BS12420.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12420.complete Sequence

488 bp assembled on 2006-11-01

GenBank Submission: FJ637169

> BS12420.complete
GAAGTTATCAGTCGACATGTCTATCGGAGTGCCCATTAAAGTTCTGCACG
AGGCCGAGGGCCACATAATCACTTGCGAAACCATCACCGGCGAGGTGTAC
CGCGGCAAACTCATCGAGGCGGAGGACAACATGAACTGCCAAATGACCCA
GATCACGGTGACCTACCGAGACGGACGCACCGCCAACCTGGAGAACGTCT
ACATTCGCGGCTCCAAGATCCGATTCCTTATACTGCCCGACATGCTGAAA
AATGCCCCGATGTTCAAGAAGCAGACGGGCAAGGGACTTGGTGGGACGGC
GGGACGGGGCAAGGCGGCCATTCTGCGCGCACAGGCTCGTGGCAGAGGAA
GAGGCGGACCTCCGGGCGGCGGAAGGGGCACTGGTGGACCGCCAGGAGCT
CCCGGCGGCAGCGGCGGACGCGGAGCATGGCAGGGAGGACCAACCGGCGG
TCGAGGACGCGGCGGCCTGTAGAAGCTTTCTAGACCAT

BS12420.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
SmD3-RA 456 CG8427-PA 1..456 17..472 2280 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
SmD3-RA 744 CG8427-RA 145..602 15..472 2290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12168875..12169195 15..335 1605 100 Plus
2R 25286936 2R 12169724..12169861 335..472 690 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:03:59 has no hits.

BS12420.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:20:34 Download gff for BS12420.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 1..456 17..472 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:52:18 Download gff for BS12420.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 145..617 10..482 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:45:33 Download gff for BS12420.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 147..602 17..472 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:20:34 Download gff for BS12420.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 145..617 10..482 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:50:12 Download gff for BS12420.complete
Subject Subject Range Query Range Percent Splice Strand
SmD3-RA 147..602 17..472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:50:12 Download gff for BS12420.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12168877..12169195 17..335 100 -> Plus
2R 12169725..12169861 336..472 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:45:33 Download gff for BS12420.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8056382..8056700 17..335 100 -> Plus
arm_2R 8057230..8057366 336..472 100   Plus

BS12420.pep Sequence

Translation from 16 to 471

> BS12420.pep
MSIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTY
RDGRTANLENVYIRGSKIRFLILPDMLKNAPMFKKQTGKGLGGTAGRGKA
AILRAQARGRGRGGPPGGGRGTGGPPGAPGGSGGRGAWQGGPTGGRGRGG
L*

BS12420.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
SmD3-PA 151 CG8427-PA 1..151 1..151 805 100 Plus
CG17768-PB 154 CG17768-PB 2..143 5..147 157 29.9 Plus
CG17768-PA 154 CG17768-PA 2..143 5..147 157 29.9 Plus
SmD1-PA 124 CG10753-PA 8..118 7..121 139 32.5 Plus