Clone BS12433 Report

Search the DGRC for BS12433

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:124
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptCG13060-RA
Protein status:BS12433.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12433.complete Sequence

428 bp assembled on 2007-10-17

GenBank Submission: FJ637177

> BS12433.complete
GAAGTTATCAGTCGACATGTTCAAATTTATCGGCGTCATCGCTCTCCTGG
TCGCCACCGCCAGTGCTGGTCTCATCGAGACTCACCATGTGGTGCACGAG
CCCGTTCTGGCCAAGGTTGGATCGGTGGTGCACTCTGCTCCCTCGGCGGT
TTCCCACCAGAGCATCACCCAGGTGCACAGCAAGGCGGTGGTGCAGCCAG
TGGTTGCTCCTATCGTGAAGACCACCACCTACTCCCATCCCGCCGTTGCC
GTCCATGCTGCTCCAGTGGTTCACTCCGTGCCCGTTGTCCACGCCGCTCC
TGTCGTCCACTCCGTTCACTCCGCTCCTGTGGTGCACTCGGTGCTTCACT
CCGCTCCCCTCGTCAAGTCAGTGGTGCACTCCGCTCCTCTGGCCTACACC
CTGCACCACTAAAAGCTTTCTAGACCAT

BS12433.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13060-RA 396 CG13060-PA 1..396 17..412 1980 100 Plus
CG13041-RA 375 CG13041-PA 1..375 17..412 1385 91.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13060-RA 539 CG13060-RA 71..467 17..413 1985 100 Plus
CG13041-RA 513 CG13041-RA 68..442 17..412 1385 91.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 17:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16319998..16320382 29..413 1925 100 Plus
3L 28110227 3L 16319025..16319381 412..35 1355 91.8 Minus
Blast to na_te.dros performed on 2014-11-27 17:00:51 has no hits.

BS12433.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:14:57 Download gff for BS12433.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 1..396 17..412 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:45:49 Download gff for BS12433.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 58..468 7..420 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:02:10 Download gff for BS12433.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 76..464 22..410 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:38:39 Download gff for BS12433.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 71..459 22..410 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:32:25 Download gff for BS12433.complete
Subject Subject Range Query Range Percent Splice Strand
CG13060-RA 76..464 22..410 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:32:25 Download gff for BS12433.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16319998..16320379 29..410 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:02:10 Download gff for BS12433.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16313098..16313479 29..410 100   Plus

BS12433.pep Sequence

Translation from 16 to 411

> BS12433.pep
MFKFIGVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSI
TQVHSKAVVQPVVAPIVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSV
HSAPVVHSVLHSAPLVKSVVHSAPLAYTLHH*

BS12433.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:31:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG13060-PA 131 CG13060-PA 1..131 1..131 659 100 Plus
CG13041-PA 124 CG13041-PA 1..124 1..131 584 90.8 Plus
CG13044-PA 155 CG13044-PA 1..150 1..127 261 47.3 Plus
CG13040-PB 185 CG13040-PB 1..144 1..131 249 45.9 Plus
CG13040-PA 185 CG13040-PA 1..144 1..131 249 45.9 Plus