Clone BS12435 Report

Search the DGRC for BS12435

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:124
Well:35
Vector:pDNR-Dual
Associated Gene/TranscriptCG8116-RA
Protein status:BS12435.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12435.complete Sequence

443 bp assembled on 2006-11-01

GenBank Submission: FJ637179

> BS12435.complete
GAAGTTATCAGTCGACATGAACGCCAGCCTCATCTATGAGATACTTATGT
ATCTGAACTCGTTCTACTTTGGCATGTACGCCGCCTTCGAAGTGGGCGTG
GGCGTTCTTAAGGCGATTAATCTAAACTACGGCGAGAACGCGTTGTCCCG
GGAGGCCAGCATCCTGCTCTCACTGTGCATCATCGAGACCGTGCGCATTG
TCTTCGGGCGGAAGAGCAGTCTAAGCGATCGTGGCTGGCAAGCAACCGCA
TCCGTAATATTAACACTGCCCAGTCTTGCTATTGTTATCTACTTGTGTTG
TTTTCAAACCTTTGTTCTCAAACTCGAAATTATTCTGAGTGCCTTAATGA
TCACCCTACAAGGTGCTGAACTAGTCTACGCCAGCATATTCATTTGTACA
ATGTGTCGCCCCGTCACATACACCTAGAAGCTTTCTAGACCAT

BS12435.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG8116-RC 411 CG8116-PC 1..411 17..427 2055 100 Plus
CG8116-RB 411 CG8116-PB 1..411 17..427 2055 100 Plus
CG8116-RA 411 CG8116-PA 1..411 17..427 2055 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG8116-RC 1826 CG8116-RC 550..961 16..427 2060 100 Plus
CG8116-RB 2812 CG8116-RB 555..966 16..427 2060 100 Plus
CG8116-RA 1831 CG8116-RA 555..966 16..427 2060 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8717124..8717342 16..234 1095 100 Plus
3R 32079331 3R 8717848..8718042 233..427 975 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:59:17 has no hits.

BS12435.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:23:10 Download gff for BS12435.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RA 1..411 17..427 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:30:43 Download gff for BS12435.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RA 564..984 16..437 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:43:40 Download gff for BS12435.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RA 556..966 17..427 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:23:10 Download gff for BS12435.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RA 564..984 16..437 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:55 Download gff for BS12435.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RA 556..966 17..427 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:35:55 Download gff for BS12435.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8717125..8717341 17..233 100 -> Plus
3R 8717849..8718042 234..427 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:43:40 Download gff for BS12435.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4542847..4543063 17..233 100 -> Plus
arm_3R 4543571..4543764 234..427 100   Plus

BS12435.pep Sequence

Translation from 16 to 426

> BS12435.pep
MNASLIYEILMYLNSFYFGMYAAFEVGVGVLKAINLNYGENALSREASIL
LSLCIIETVRIVFGRKSSLSDRGWQATASVILTLPSLAIVIYLCCFQTFV
LKLEIILSALMITLQGAELVYASIFICTMCRPVTYT*

BS12435.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG8116-PC 136 CG8116-PC 1..136 1..136 677 100 Plus
CG8116-PB 136 CG8116-PB 1..136 1..136 677 100 Plus
CG8116-PA 136 CG8116-PA 1..136 1..136 677 100 Plus
CG11760-PB 149 CG11760-PB 15..148 2..135 346 48.5 Plus