Clone BS12443 Report

Search the DGRC for BS12443

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:124
Well:43
Vector:pDNR-Dual
Associated Gene/TranscriptCG32850-RA
Protein status:BS12443.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12443.complete Sequence

476 bp assembled on 2006-11-01

GenBank Submission: FJ637181

> BS12443.complete
GAAGTTATCAGTCGACATGGGTAATTGCTTAAAAATTAGCACTTCAGATG
ACATTTCACTTTTACGCGGCAATGACAGTCAAATCAGCGGGACACAGCCA
GTGTATCATCAGGGAGAGCATTATCAACGAGAATTGTACCCTTCCACGTC
GTCTTCGACAACGCTAACACCATCTTCTAACAATCGTCAACTTTCCGATG
AAAATCAAGTGAAAATTGCAAAGCGAATTGGATTAATGCAGTACTTGCCA
ATAGGAACATACGACGGGAGCTCAAAGAAAGCACGAGAATGTGTTATCTG
CATGGCTGAATTTTGTGTTAATGAAGCCGTACGTTATCTACCTTGCATGC
ATATTTATCATGTTAATTGTATAGATGATTGGTTGTTGAGAAGTCTAACT
TGTCCCAGTTGTTTAGAGCCTGTTGATGCTGCCTTGCTGACGAGTTATGA
ATCGACATAGAAGCTTTCTAGACCAT

BS12443.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG32850-RA 444 CG32850-PA 1..444 17..460 2220 100 Plus
CG32850-RB 441 CG32850-PB 1..441 17..460 2140 99.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG32850-RA 2311 CG32850-RA 282..725 17..460 2220 100 Plus
CG32850-RB 3965 CG32850-RB 60..500 17..460 2140 99.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 319445..319799 106..460 1760 99.7 Plus
4 1348131 4 316417..316509 17..109 465 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:16:15 has no hits.

BS12443.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:19:11 Download gff for BS12443.complete
Subject Subject Range Query Range Percent Splice Strand
CG32850-RA 1..444 17..460 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:00:15 Download gff for BS12443.complete
Subject Subject Range Query Range Percent Splice Strand
CG32850-RA 253..706 9..466 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:48:49 Download gff for BS12443.complete
Subject Subject Range Query Range Percent Splice Strand
CG32850-RA 282..725 17..460 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:19:11 Download gff for BS12443.complete
Subject Subject Range Query Range Percent Splice Strand
CG32850-RA 253..706 9..466 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:17:26 Download gff for BS12443.complete
Subject Subject Range Query Range Percent Splice Strand
CG32850-RA 282..725 17..460 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:17:26 Download gff for BS12443.complete
Subject Subject Range Query Range Percent Splice Strand
4 316417..316509 17..109 100 -> Plus
4 319449..319799 110..460 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:48:49 Download gff for BS12443.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 337043..337135 17..109 100 -> Plus
arm_4 340075..340425 110..460 100   Plus

BS12443.pep Sequence

Translation from 16 to 459

> BS12443.pep
MGNCLKISTSDDISLLRGNDSQISGTQPVYHQGEHYQRELYPSTSSSTTL
TPSSNNRQLSDENQVKIAKRIGLMQYLPIGTYDGSSKKARECVICMAEFC
VNEAVRYLPCMHIYHVNCIDDWLLRSLTCPSCLEPVDAALLTSYEST*

BS12443.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32850-PA 147 CG32850-PA 1..147 1..147 783 100 Plus
CG32850-PB 146 CG32850-PB 1..146 1..147 766 99.3 Plus