Clone BS12446 Report

Search the DGRC for BS12446

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:124
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG13993-RA
Protein status:BS12446.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12446.complete Sequence

413 bp assembled on 2006-11-01

GenBank Submission: FJ637184

> BS12446.complete
GAAGTTATCAGTCGACATGGCACAAATGGACATCGAATTGAAGAAGGCCT
TCACCGAGATGCAGATCAATAAGCTGGAGACGACCAAGAAGATCCACATG
ATCGACATGAAGTGCGACATGGTCAAGACAGGCAAACAAAAGTACCAGCT
GACAGAAAAGGGCACCAGCAGCTTGGCCGACGACACAAGAGTTTACCAGT
CCGTGGGTCGCATGTTCCTGCTTACCGATGTACAGAATATGCGCGAGGAC
CTGAAGGCTAGGCAGGAGAAATGCGACAAAGCGATAGAACTGCTGGAGAA
GAAGAAGGAGTTCTTGCAGAAGTCCCTTAAGAGCCAGGAAGACGGTCTGC
GCGAGTTGGTGCAGCAGCGCAAGGAAGCCGATCAGACTGCGAAATAGAAG
CTTTCTAGACCAT

BS12446.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13993-RB 381 CG13993-PB 1..381 17..397 1905 100 Plus
CG13993-RA 381 CG13993-PA 1..381 17..397 1905 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG13993-RB 575 CG13993-RB 123..504 17..398 1910 100 Plus
CG13993-RA 595 CG13993-RA 143..524 17..398 1910 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6069557..6069767 188..398 1055 100 Plus
2L 23513712 2L 6069345..6069489 45..189 725 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:46:49 has no hits.

BS12446.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:47:21 Download gff for BS12446.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 1..381 17..397 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:35:15 Download gff for BS12446.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 108..502 6..402 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:09:34 Download gff for BS12446.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 143..517 17..391 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:47:21 Download gff for BS12446.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 108..502 6..402 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:27:19 Download gff for BS12446.complete
Subject Subject Range Query Range Percent Splice Strand
CG13993-RA 143..517 17..391 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:27:19 Download gff for BS12446.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6069221..6069250 17..46 100 -> Plus
2L 6069347..6069489 47..189 100 -> Plus
2L 6069559..6069760 190..391 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:09:34 Download gff for BS12446.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6069221..6069250 17..46 100 -> Plus
arm_2L 6069347..6069489 47..189 100 -> Plus
arm_2L 6069559..6069760 190..391 100   Plus

BS12446.pep Sequence

Translation from 16 to 396

> BS12446.pep
MAQMDIELKKAFTEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGT
SSLADDTRVYQSVGRMFLLTDVQNMREDLKARQEKCDKAIELLEKKKEFL
QKSLKSQEDGLRELVQQRKEADQTAK*

BS12446.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13993-PB 126 CG13993-PB 1..126 1..126 629 100 Plus
CG13993-PA 126 CG13993-PA 1..126 1..126 629 100 Plus