Clone BS12453 Report

Search the DGRC for BS12453

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:124
Well:53
Vector:pDNR-Dual
Associated Gene/TranscriptCG11151-RA
Protein status:BS12453.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12453.complete Sequence

380 bp assembled on 2006-11-01

GenBank Submission: FJ637188

> BS12453.complete
GAAGTTATCAGTCGACATGTCTCTGCAGTCGGACGCCGTTTTCCAAAAGA
TCATCGATGGACTGAAGGAGAACGAGGCCAAGGCCAAGGCGGTCAACGGT
GTGTTCCTGTACAAAATCACCAAGGACGGCAAGGTGGCCAAGGAGTGGAC
TCTGGACTGCAAGAACGCCAAGGCCTACGAGGGACCTGCCCAGGGCATCA
AGGTGGACACCACCTTGACGGTCGCCGACGAGGACATGGTTGACATCGCC
CTGGGCAAGCTGAACCCCCAGGCTGCCTTCATGAAGGGCAAGCTGAAGAT
CGCCGGCAACATCATGCTCACCCAGAAGCTGGCGCCGCTCCTGAAGACCG
ACGCCAAGTTGTAAAAGCTTTCTAGACCAT

BS12453.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG11151-RB 348 CG11151-PB 1..348 17..364 1740 100 Plus
CG11151-RA 348 CG11151-PA 1..348 17..364 1740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG11151-RB 1066 CG11151-RB 198..548 16..366 1755 100 Plus
CG11151-RA 705 CG11151-RA 148..498 16..366 1755 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13740678..13740894 150..366 1085 100 Plus
X 23542271 X 13739979..13740112 16..149 670 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:39:13 has no hits.

BS12453.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:47:19 Download gff for BS12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 1..348 17..364 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:58:53 Download gff for BS12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 141..498 9..366 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:56:43 Download gff for BS12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 149..494 17..362 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:47:20 Download gff for BS12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 141..498 9..366 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:24:11 Download gff for BS12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG11151-RA 149..494 17..362 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:24:11 Download gff for BS12453.complete
Subject Subject Range Query Range Percent Splice Strand
X 13739980..13740112 17..149 100 -> Plus
X 13740678..13740890 150..362 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:56:43 Download gff for BS12453.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13634013..13634145 17..149 100 -> Plus
arm_X 13634711..13634923 150..362 100   Plus

BS12453.pep Sequence

Translation from 16 to 363

> BS12453.pep
MSLQSDAVFQKIIDGLKENEAKAKAVNGVFLYKITKDGKVAKEWTLDCKN
AKAYEGPAQGIKVDTTLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIM
LTQKLAPLLKTDAKL*

BS12453.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG11151-PB 115 CG11151-PB 1..115 1..115 576 100 Plus
CG11151-PA 115 CG11151-PA 1..115 1..115 576 100 Plus