Clone BS12463 Report

Search the DGRC for BS12463

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:124
Well:63
Vector:pDNR-Dual
Associated Gene/TranscriptCG14265-RB
Protein status:BS12463.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12463.complete Sequence

392 bp assembled on 2006-11-01

GenBank Submission: FJ637194

> BS12463.complete
GAAGTTATCAGTCGACATGAAGCTCCACTGGCTGCTATTAGCAGTCGTAC
TGATCTGTGCCCTGTACAGCGCTACGGGCACCAGCCCCACCACGGAAACC
AGCACCAGCACCGAGTCGACCACCGCTACGGGCTCAAGCACTTCGACAAC
CTCGGCCAGCACCTCCTCCTCATCCTCGGACACCACCGAGGCCAGCAGCA
GCAGCAGCGATTCGTCCACCAGTTCCAGCAGCTCGTCCTCTAGCTCCAGC
AGTTCATCCAAGAAGAAGGCTGCCGCCAGAAGGAGGCGTGCCGCTCGCAG
GAGGCGTCGTGCCGCACGCAGGAGACGTGCTGCTGCCGCTCGCAGGCGCG
CCCAGCGCAGGCGCAACAGGGGTTAGAAGCTTTCTAGACCAT

BS12463.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG14265-RB 360 CG14265-PB 1..360 17..376 1800 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG14265-RB 557 CG14265-RB 35..395 17..377 1805 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3236292..3236652 377..17 1805 100 Minus
Blast to na_te.dros performed on 2014-11-27 19:38:02 has no hits.

BS12463.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 23:44:34 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:19:13 Download gff for BS12463.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 20..393 5..381 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:01:33 Download gff for BS12463.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 35..394 17..376 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:44:34 Download gff for BS12463.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 20..393 5..381 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:05:16 Download gff for BS12463.complete
Subject Subject Range Query Range Percent Splice Strand
CG14265-RB 35..394 17..376 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:05:16 Download gff for BS12463.complete
Subject Subject Range Query Range Percent Splice Strand
X 3236293..3236652 17..376 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:01:33 Download gff for BS12463.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3130326..3130685 17..376 100   Minus

BS12463.pep Sequence

Translation from 16 to 375

> BS12463.pep
MKLHWLLLAVVLICALYSATGTSPTTETSTSTESTTATGSSTSTTSASTS
SSSSDTTEASSSSSDSSTSSSSSSSSSSSSSKKKAAARRRRAARRRRRAA
RRRRAAAARRRAQRRRNRG*

BS12463.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14265-PB 119 CG14265-PB 1..119 1..119 556 100 Plus
CG14453-PA 133 CG14453-PA 1..117 1..118 238 49.2 Plus
CG32453-PB 120 CG32453-PB 1..103 1..118 205 46.6 Plus
CG32453-PA 120 CG32453-PA 1..103 1..118 205 46.6 Plus
CG14454-PB 120 CG14454-PB 1..103 1..118 205 46.6 Plus
CG14453-PA 133 CG14453-PA 44..125 18..118 181 45.1 Plus