Clone BS12482 Report

Search the DGRC for BS12482

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:124
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptCG7787-RA
Protein status:BS12482.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12482.complete Sequence

401 bp assembled on 2006-11-01

GenBank Submission: FJ637201

> BS12482.complete
GAAGTTATCAGTCGACATGACAGAGGAAGCTGATTTTAGCGAGCAAATCA
CCGATGGGAAAAACAAATCAAATGTGCGCTGCCAGTTTTGCAACTGTTTG
ATGCTGAAAGCACAAGAGGGCACCTACAACCAGGAGGAGGTGGATGTGCC
ACTGATGACGCAGAAGCAGGATCGAACGGCGGACAGCCTAAACAGCGAGC
CACTGAAAGACTTCTGGCTGGTCAAGGACATGATGACATTCGAGAACATC
GGGTTCTCCAACACGGTGGACGGCAGAAAGTTTCTGGTTTGCGCGGACTG
CGAGCGAGGACCTGTGGGCTACCATGATCTGAGCACCCGCCACTGCTATC
TGGCCCTCAAGAGGGTGGTGCACAAGGACACCTAGAAGCTTTCTAGACCA
T

BS12482.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG7787-RA 369 CG7787-PA 1..369 17..385 1845 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG7787-RA 888 CG7787-RA 82..450 17..385 1845 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8320600..8320847 138..385 1240 100 Plus
2L 23513712 2L 8320409..8320533 17..141 625 100 Plus
Blast to na_te.dros performed on 2014-11-27 23:53:57 has no hits.

BS12482.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:44:22 Download gff for BS12482.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 1..369 17..385 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:54:58 Download gff for BS12482.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 86..458 17..389 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:41:00 Download gff for BS12482.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 82..450 17..385 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:44:23 Download gff for BS12482.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 86..458 17..389 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:10:30 Download gff for BS12482.complete
Subject Subject Range Query Range Percent Splice Strand
CG7787-RA 82..450 17..385 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:10:30 Download gff for BS12482.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8320409..8320531 17..139 100 -> Plus
2L 8320602..8320847 140..385 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:41:00 Download gff for BS12482.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8320602..8320847 140..385 100   Plus
arm_2L 8320409..8320531 17..139 100 -> Plus

BS12482.pep Sequence

Translation from 16 to 384

> BS12482.pep
MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCYLALKRVVHKDT*

BS12482.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG7787-PA 122 CG7787-PA 1..122 1..122 659 100 Plus