Clone BS12488 Report

Search the DGRC for BS12488

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:124
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptObp56a-RA
Protein status:BS12488.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12488.complete Sequence

452 bp assembled on 2006-11-01

GenBank Submission: FJ637204

> BS12488.complete
GAAGTTATCAGTCGACATGAACTCCTACTTCGTGATCGCTTTGAGTGCTC
TTTTTGTGACTCTGGCTGTTGGATCGTCCCTTAATCTGAGCGACGAGCAG
AAGGATCTGGCCAAGCAGCATCGTGAGCAGTGCGCCGAGGAAGTGAAACT
TACCGAGGAGGAAAAGGCCAAGGTCAATGCCAAGGACTTCAATAACCCCA
CCGAGAACATCAAGTGCTTTGCCAACTGCTTCTTCGAGAAGGTCGGAACC
CTGAAGGACGGTGAGCTGCAGGAGTCAGTGGTGCTGGAGAAGCTCGGCGC
TCTCATTGGCGAGGAGAAGACCAAGGCGGCTCTGGAGAAGTGCAGGACCA
TCAAGGGCGAGAACAAGTGTGATACCGCCTCCAAGTTGTACGATTGCTTC
GAGAGCTTCAAGCCCGCCCCCGAGGCTAAGGCCTAAAAGCTTTCTAGACC
AT

BS12488.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56a-RA 420 CG11797-PA 1..420 17..436 2100 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56a-RA 547 CG11797-RA 46..468 15..437 2115 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19698068..19698429 76..437 1810 100 Plus
2R 25286936 2R 19697768..19697829 15..76 310 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:05:44 has no hits.

BS12488.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:44:25 Download gff for BS12488.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 1..420 17..436 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:19:01 Download gff for BS12488.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 34..468 2..437 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:15:32 Download gff for BS12488.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 48..465 17..434 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:44:25 Download gff for BS12488.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 34..468 2..437 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:53 Download gff for BS12488.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56a-RA 48..465 17..434 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:12:53 Download gff for BS12488.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19697770..19697829 17..76 100 -> Plus
2R 19698069..19698426 77..434 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:15:32 Download gff for BS12488.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15585275..15585334 17..76 100 -> Plus
arm_2R 15585574..15585931 77..434 100   Plus

BS12488.pep Sequence

Translation from 16 to 435

> BS12488.pep
MNSYFVIALSALFVTLAVGSSLNLSDEQKDLAKQHREQCAEEVKLTEEEK
AKVNAKDFNNPTENIKCFANCFFEKVGTLKDGELQESVVLEKLGALIGEE
KTKAALEKCRTIKGENKCDTASKLYDCFESFKPAPEAKA*

BS12488.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56a-PA 139 CG11797-PA 1..139 1..139 711 100 Plus
Obp56d-PB 131 CG11218-PB 3..124 5..128 265 42.7 Plus
Obp56d-PA 131 CG11218-PA 3..124 5..128 265 42.7 Plus
Obp56e-PA 132 CG8462-PA 1..125 1..128 245 37.5 Plus
Obp56e-PB 131 CG8462-PB 1..124 1..128 234 36.7 Plus