Clone BS12536 Report

Search the DGRC for BS12536

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:125
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptCG4962-RA
Protein status:BS12536.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12536.complete Sequence

404 bp assembled on 2006-11-01

GenBank Submission: FJ637214

> BS12536.complete
GAAGTTATCAGTCGACATGTTCAAACTGATTGCCCTCATCTCTGCCCTGT
GCGCCGTGGCCAATGCCGGAGTAATCTCGCCCTACAGCCATGGATATGGA
CTGGGATACGGCGCCGCCTTGGCTCCGGCTTATGCCGCTCCGGCTGTGAT
CTCGCACGCCCCGATCATCAAGAGCTACGCCGCTCCCATTGTCGCCCACC
CGGTGGCCACCTCCTATGCCAACACCTACAAGGTGGCCACCAAGGCCATT
CCAGTGGTCCATGCCGCTCCTCTGGTCCATGCCGTGCCTGCTCTGCACTC
CACCTCCACCTACCATGGATCCTATGGCGGCTACGGTAGCTACGGTCTGG
GATACGCCGGCTACGGACACGGAGCCTACCTGCACTAAAAGCTTTCTAGA
CCAT

BS12536.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG4962-RA 372 CG4962-PA 1..372 17..388 1860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG4962-RA 774 CG4962-RA 65..436 17..388 1860 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16295049..16295409 388..28 1805 100 Minus
Blast to na_te.dros performed 2014-11-27 14:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 5581..5623 283..244 109 76.7 Minus

BS12536.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:43:58 Download gff for BS12536.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 1..372 17..388 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:18:27 Download gff for BS12536.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 51..429 9..388 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:55 Download gff for BS12536.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 70..434 22..386 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:43:58 Download gff for BS12536.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 51..429 9..388 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:13:06 Download gff for BS12536.complete
Subject Subject Range Query Range Percent Splice Strand
CG4962-RA 70..434 22..386 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:13:06 Download gff for BS12536.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16295051..16295411 22..386 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:55 Download gff for BS12536.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16288151..16288511 22..386 98   Minus

BS12536.pep Sequence

Translation from 16 to 387

> BS12536.pep
MFKLIALISALCAVANAGVISPYSHGYGLGYGAALAPAYAAPAVISHAPI
IKSYAAPIVAHPVATSYANTYKVATKAIPVVHAAPLVHAVPALHSTSTYH
GSYGGYGSYGLGYAGYGHGAYLH*

BS12536.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG4962-PA 123 CG4962-PA 1..123 1..123 646 100 Plus
CG13041-PA 124 CG13041-PA 1..106 1..102 153 34.9 Plus
CG13060-PA 131 CG13060-PA 1..99 1..95 144 36.4 Plus