Clone BS12537 Report

Search the DGRC for BS12537

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:125
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG31337-RA
Protein status:BS12537.pep: full length peptide match
Sequenced Size:347

Clone Sequence Records

BS12537.complete Sequence

347 bp assembled on 2010-07-02

GenBank Submission: KX804241

> BS12537.complete
GAAGTTATCAGTCGACATGCGGCGCGCATCTCGATTGATTCCGTTCGGTT
TCGTCATCCTGCTCCTGATTCTTCTGCTCCTCCAGCCATCGACAGACGGC
CACACACTGGGCGCCAGCTGCCAGACGCCCGAGAAGAGCGAAGGACGCTG
TGTGCACTTCAGCTCCTGCCGGCTCGTCTTGCGTCACTATGCGATGTACA
AGGAGCACATGCCGCCAGCGATAATGCGATTCCTGCAGAGGGTCCGTTGC
AAGCCGAAACGCGAAGGCTATCATTTGTGCTGCGAACTCAAAGATGTGAT
TCCCGCGAACGCCAACTCCAAGTTGAAGTAAAAGCTTTCTAGACCAT

BS12537.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-RA 315 CG31337-PA 1..315 17..331 1575 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-RA 849 CG31337-RA 186..501 17..332 1580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13544546..13544706 268..108 805 100 Minus
3R 32079331 3R 13545125..13545215 107..17 455 100 Minus
3R 32079331 3R 13544314..13544377 332..269 320 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:18:13 has no hits.

BS12537.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:04 Download gff for BS12537.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 170..482 17..329 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:16:03 Download gff for BS12537.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 170..482 17..329 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:26:14 Download gff for BS12537.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 186..498 17..329 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:26:14 Download gff for BS12537.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13544317..13544377 269..329 100 <- Minus
3R 13544546..13544706 108..268 100 <- Minus
3R 13545125..13545215 17..107 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:16:03 Download gff for BS12537.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9370039..9370099 269..329 100 <- Minus
arm_3R 9370268..9370428 108..268 100 <- Minus
arm_3R 9370847..9370937 17..107 100   Minus

BS12537.5prime Sequence

308 bp (308 high quality bases) assembled on 2010-02-21

> BS12537.5prime
TCCGTTCGGTTTCGTCATCCTGCTCCTGATTCTTCTGCTCCTCCAGCCAT
CGACAGACGGCCACACACTGGGCGCCAGCTGCCAGACGCCCGAGAAGAGC
GAAGGACGCTGTGTGCACTTCAGCTCCTGCCGGCTCGTCTTGCGTCACTA
TGCGATGTACAAGGAGCACATGCCGCCAGCGATAATGCGATTCCTGCAGA
GGGTCCGTTGCAAGCCGAAACGCGAAGGCTATCATTTGTGCTGCGAACTC
AAAGATGTGATTCCCGCGAACGCCAACTCCAAGTTGAAGTAAAAGCTTTC
TAGACCAT

BS12537.5prime Blast Records

Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-RA 849 CG31337-RA 209..501 1..293 1465 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13544546..13544706 229..69 805 100 Minus
3R 32079331 3R 13545125..13545192 68..1 340 100 Minus
3R 32079331 3R 13544314..13544377 293..230 320 100 Minus
Blast to na_te.dros performed on 2015-02-10 15:36:05 has no hits.

BS12537.5prime Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-21 04:42:25 Download gff for BS12537.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 193..485 1..293 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 12:20:14 Download gff for BS12537.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 193..485 1..293 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:36:43 Download gff for BS12537.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 209..501 1..293 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 17:36:43 Download gff for BS12537.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 13544314..13544377 230..293 100 <- Minus
3R 13544546..13544706 69..229 100 <- Minus
3R 13545125..13545192 1..68 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 12:20:14 Download gff for BS12537.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9370036..9370099 230..293 100 <- Minus
arm_3R 9370268..9370428 69..229 100 <- Minus
arm_3R 9370847..9370914 1..68 100   Minus

BS12537.pep Sequence

Translation from 16 to 330

> BS12537.pep
MRRASRLIPFGFVILLLILLLLQPSTDGHTLGASCQTPEKSEGRCVHFSS
CRLVLRHYAMYKEHMPPAIMRFLQRVRCKPKREGYHLCCELKDVIPANAN
SKLK*

BS12537.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-PA 104 CG31337-PA 1..104 1..104 554 100 Plus