BS12574.complete Sequence
398 bp assembled on 2006-11-01
GenBank Submission: FJ637220
> BS12574.complete
GAAGTTATCAGTCGACATGAGTGCGATTTCTAATGAAGACATTATTTGGA
CCATAAAGAACGGAGAGTTCGATGCTGTGCAAGACGCTTTTCAGAATGAT
GCACAAAAGGTGAATGAGGAAATCAAGGGCCGTTTTCCAGTACACTATGC
AGCAGATTTTGGACAACTGAATGTCCTGGAGTTTCTTATAAGCTTAGGAG
CAGACATAAATAGAAAGGACAAACATGGTATTACCCCCATTCTGGCTGCC
ATTTGGGAAGGACATACGAGCTGTGTGGAATTACTTCTAAAAATGGGAGC
TGATAAAAATGGTTCTACTCCAGATGGCCAAAGCTACCTCGAGGCGGCGG
AAAAAGACGAGATTAAGAAACTCCTTGCATAAAAGCTTTCTAGACCAT
BS12574.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:00:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31715-RA | 366 | CG31715-PA | 1..366 | 17..382 | 1830 | 100 | Plus |
CG31715-RB | 360 | CG31715-PB | 1..360 | 17..382 | 1705 | 98.4 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:00:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31715-RA | 580 | CG31715-RA | 67..432 | 17..382 | 1830 | 100 | Plus |
CG31715-RB | 574 | CG31715-RB | 67..426 | 17..382 | 1705 | 98.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:00:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10341822..10341932 | 101..211 | 555 | 100 | Plus |
2L | 23513712 | 2L | 10342288..10342375 | 295..382 | 440 | 100 | Plus |
2L | 23513712 | 2L | 10342150..10342234 | 212..296 | 425 | 100 | Plus |
2L | 23513712 | 2L | 10341682..10341766 | 17..101 | 425 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 00:00:53 has no hits.
BS12574.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:44:07 Download gff for
BS12574.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31715-RA | 1..366 | 17..382 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:54:56 Download gff for
BS12574.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31715-RA | 62..427 | 17..382 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:16:02 Download gff for
BS12574.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31715-RA | 67..430 | 17..380 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:44:07 Download gff for
BS12574.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31715-RA | 62..427 | 17..382 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:24:40 Download gff for
BS12574.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31715-RA | 67..430 | 17..380 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:24:40 Download gff for
BS12574.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10341682..10341765 | 17..100 | 100 | -> | Plus |
2L | 10341822..10341932 | 101..211 | 100 | -> | Plus |
2L | 10342150..10342233 | 212..295 | 100 | -> | Plus |
2L | 10342289..10342373 | 296..380 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:16:02 Download gff for
BS12574.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 10341682..10341765 | 17..100 | 100 | -> | Plus |
arm_2L | 10341822..10341932 | 101..211 | 100 | -> | Plus |
arm_2L | 10342150..10342233 | 212..295 | 100 | -> | Plus |
arm_2L | 10342289..10342373 | 296..380 | 100 | | Plus |
BS12574.pep Sequence
Translation from 16 to 381
> BS12574.pep
MSAISNEDIIWTIKNGEFDAVQDAFQNDAQKVNEEIKGRFPVHYAADFGQ
LNVLEFLISLGADINRKDKHGITPILAAIWEGHTSCVELLLKMGADKNGS
TPDGQSYLEAAEKDEIKKLLA*
BS12574.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:39:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31715-PA | 121 | CG31715-PA | 1..121 | 1..121 | 625 | 100 | Plus |
CG31715-PB | 119 | CG31715-PB | 1..119 | 1..121 | 602 | 98.3 | Plus |
CG7423-PA | 124 | CG7423-PA | 8..122 | 7..121 | 397 | 61.7 | Plus |
Tnks-PA | 1181 | CG4719-PA | 686..788 | 18..120 | 148 | 33 | Plus |
Tnks-PB | 1520 | CG4719-PB | 686..788 | 18..120 | 148 | 33 | Plus |