Clone BS12574 Report

Search the DGRC for BS12574

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:125
Well:74
Vector:pDNR-Dual
Associated Gene/TranscriptCG31715-RA
Protein status:BS12574.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12574.complete Sequence

398 bp assembled on 2006-11-01

GenBank Submission: FJ637220

> BS12574.complete
GAAGTTATCAGTCGACATGAGTGCGATTTCTAATGAAGACATTATTTGGA
CCATAAAGAACGGAGAGTTCGATGCTGTGCAAGACGCTTTTCAGAATGAT
GCACAAAAGGTGAATGAGGAAATCAAGGGCCGTTTTCCAGTACACTATGC
AGCAGATTTTGGACAACTGAATGTCCTGGAGTTTCTTATAAGCTTAGGAG
CAGACATAAATAGAAAGGACAAACATGGTATTACCCCCATTCTGGCTGCC
ATTTGGGAAGGACATACGAGCTGTGTGGAATTACTTCTAAAAATGGGAGC
TGATAAAAATGGTTCTACTCCAGATGGCCAAAGCTACCTCGAGGCGGCGG
AAAAAGACGAGATTAAGAAACTCCTTGCATAAAAGCTTTCTAGACCAT

BS12574.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:00:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-RA 366 CG31715-PA 1..366 17..382 1830 100 Plus
CG31715-RB 360 CG31715-PB 1..360 17..382 1705 98.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:00:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-RA 580 CG31715-RA 67..432 17..382 1830 100 Plus
CG31715-RB 574 CG31715-RB 67..426 17..382 1705 98.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10341822..10341932 101..211 555 100 Plus
2L 23513712 2L 10342288..10342375 295..382 440 100 Plus
2L 23513712 2L 10342150..10342234 212..296 425 100 Plus
2L 23513712 2L 10341682..10341766 17..101 425 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:00:53 has no hits.

BS12574.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:44:07 Download gff for BS12574.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 1..366 17..382 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:54:56 Download gff for BS12574.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 62..427 17..382 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:16:02 Download gff for BS12574.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 67..430 17..380 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:44:07 Download gff for BS12574.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 62..427 17..382 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:24:40 Download gff for BS12574.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 67..430 17..380 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:24:40 Download gff for BS12574.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10341682..10341765 17..100 100 -> Plus
2L 10341822..10341932 101..211 100 -> Plus
2L 10342150..10342233 212..295 100 -> Plus
2L 10342289..10342373 296..380 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:16:02 Download gff for BS12574.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10341682..10341765 17..100 100 -> Plus
arm_2L 10341822..10341932 101..211 100 -> Plus
arm_2L 10342150..10342233 212..295 100 -> Plus
arm_2L 10342289..10342373 296..380 100   Plus

BS12574.pep Sequence

Translation from 16 to 381

> BS12574.pep
MSAISNEDIIWTIKNGEFDAVQDAFQNDAQKVNEEIKGRFPVHYAADFGQ
LNVLEFLISLGADINRKDKHGITPILAAIWEGHTSCVELLLKMGADKNGS
TPDGQSYLEAAEKDEIKKLLA*

BS12574.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-PA 121 CG31715-PA 1..121 1..121 625 100 Plus
CG31715-PB 119 CG31715-PB 1..119 1..121 602 98.3 Plus
CG7423-PA 124 CG7423-PA 8..122 7..121 397 61.7 Plus
Tnks-PA 1181 CG4719-PA 686..788 18..120 148 33 Plus
Tnks-PB 1520 CG4719-PB 686..788 18..120 148 33 Plus