Clone BS12575 Report

Search the DGRC for BS12575

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:125
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG11562-RA
Protein status:BS12575.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12575.complete Sequence

410 bp assembled on 2006-11-01

GenBank Submission: FJ637221

> BS12575.complete
GAAGTTATCAGTCGACATGTCGACCGCTTCGCGAGTGACTTTGGGACTGG
CGGTCTCCATTTCCACAGCGATCATAGGTTATGTGCACTATAAACAATCG
GCAGACCGCCTGAGACTGCACGATGGTGTCCTGAGGGACGTTGAGCAGCA
ACAACGGCGCAAACACGAGAATACCTACACGCTGCAGCAGCAAATAGACA
TGACCAAGCAACTGAAAGCCAGGGAGGCGTCTAGCAACTCCTCTGACACG
CCCGTACCTCCATCGACGCATCGCGCACAGAGTAATCTTCAAGCGGAGAA
GCCAGCAGTGCAAAATGAAGGCGAGGCTTTCAGAGGTGTTCCTCAGGGTG
GAACGACTAATCACGATGGAAGCCCGCCAACTGACATAGCTTGAAAGCTT
TCTAGACCAT

BS12575.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG11562-RA 378 CG11562-PA 1..378 17..394 1890 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG11562-RA 748 CG11562-RA 150..528 16..394 1895 100 Plus
U2af38-RB 1655 CG3582-RB 1612..1655 394..351 220 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 292716..293002 108..394 1435 100 Plus
2L 23513712 2L 292568..292660 16..108 465 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:51:40 has no hits.

BS12575.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:18:13 Download gff for BS12575.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 99..481 9..394 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:34:06 Download gff for BS12575.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 151..527 17..393 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:43:48 Download gff for BS12575.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 99..481 9..394 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:28:07 Download gff for BS12575.complete
Subject Subject Range Query Range Percent Splice Strand
CG11562-RA 151..527 17..393 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:28:07 Download gff for BS12575.complete
Subject Subject Range Query Range Percent Splice Strand
2L 292569..292660 17..108 100 -> Plus
2L 292717..293001 109..393 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:34:06 Download gff for BS12575.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 292569..292660 17..108 100 -> Plus
arm_2L 292717..293001 109..393 100   Plus

BS12575.pep Sequence

Translation from 16 to 393

> BS12575.pep
MSTASRVTLGLAVSISTAIIGYVHYKQSADRLRLHDGVLRDVEQQQRRKH
ENTYTLQQQIDMTKQLKAREASSNSSDTPVPPSTHRAQSNLQAEKPAVQN
EGEAFRGVPQGGTTNHDGSPPTDIA*

BS12575.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG11562-PA 125 CG11562-PA 1..125 1..125 637 100 Plus