Clone BS12625 Report

Search the DGRC for BS12625

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:126
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptCG13021-RA
Protein status:BS12625.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12625.3prime Sequence

363 bp (363 high quality bases) assembled on 2006-10-13

> BS12625.3prime
ATGGTCTAGAAAGCTTTCAATTGAGTTCTTCTTCCTTCCCAAAGGATCCT
TCGTCCTTATCAGCCCCCTCGAGTTCCCGCTTGATCGGATTACCGATTCG
TACATTGATGATCCTTTGCTTGTCCTTGCGGCTATGTCCCTTTAATGACT
TAACAGTGAAGCCGAGGACAACGCAAGCCACAGTGGCCACGCCCACGCAC
ATCAGAGCCTTGTGGGCGGGGCGCAGATTGCCCAGATTATTGCCCAAGTT
CTCCAGGCTGCCCAATCGTCCCAATCCTTTGGGCGCAACTTTAGGCAGAA
GTGCCAGCTGATCCGTCAAGTTGGACAGAAACTTTGAGTAGTCCGACATG
TCGACTGATAACT

BS12625.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13021-PA 333 CG13021-RA 1..333 349..17 1665 100 Minus
CG13021-PB 333 CG13021-RB 1..333 349..17 1665 100 Minus
CG13021-PC 333 CG13021-RC 1..333 349..17 1665 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13021-RB 611 CG13021-RB 114..446 349..17 1665 100 Minus
CG13021-RA 597 CG13021-RA 100..432 349..17 1665 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3515260..3515592 349..17 1665 100 Minus
Blast to na_te.dros performed 2015-02-12 03:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
diver2 4917 diver2 DIVER2 4917bp 2659..2709 346..298 105 72.5 Minus

BS12625.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:31:38 Download gff for BS12625.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13021-PC 1..333 17..349 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:31:59 Download gff for BS12625.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 93..432 17..355 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:49:50 Download gff for BS12625.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 93..432 17..355 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:49:50 Download gff for BS12625.3prime
Subject Subject Range Query Range Percent Splice Strand
X 3515253..3515592 17..355 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:31:59 Download gff for BS12625.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 3409286..3409625 17..355 99   Minus

BS12625.5prime Sequence

363 bp (363 high quality bases) assembled on 2006-10-13

> BS12625.5prime
GAAGTTATCAGTCGACATGTCGGACTACTCAAAGTTTCTGTCCAACTTGA
CGGATCAGCTGGCACTTCTGCCTAAAGTTGCGCCCAAAGGATTGGGACGA
TTGGGCAGCCTGGAGAACTTGGGCAATAATCTGGGCAATCTGCGCCCCGC
CCACAAGGCTCTGATGTGCGTGGGCGTGGCCACTGTGGCTTGCGTTGTCC
TCGGCTTCACTGTTAAGTCATTAAAGGGACATAGCCGCAAGGACAAGCAA
AGGATCATCAATGTACGAATCGGTAATCCGATCAAGCGGGAACTCGAGGG
GGCTGATAAGGACGAAGGATCCTTTGGGAAGGAAGAAGAACTCAATTGAA
AGCTTTCTAGACC

BS12625.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13021-PA 333 CG13021-RA 1..333 17..349 1665 100 Plus
CG13021-PB 333 CG13021-RB 1..333 17..349 1665 100 Plus
CG13021-PC 333 CG13021-RC 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG13021-RB 611 CG13021-RB 114..446 17..349 1665 100 Plus
CG13021-RA 597 CG13021-RA 100..432 17..349 1665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3515260..3515592 17..349 1665 100 Plus
Blast to na_te.dros performed 2015-02-10 17:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
diver2 4917 diver2 DIVER2 4917bp 2659..2709 20..68 105 72.5 Plus

BS12625.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:31:39 Download gff for BS12625.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13021-PC 1..333 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:42:14 Download gff for BS12625.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 93..432 11..349 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:59:15 Download gff for BS12625.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 93..432 11..349 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:59:15 Download gff for BS12625.5prime
Subject Subject Range Query Range Percent Splice Strand
X 3515253..3515592 11..349 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:42:14 Download gff for BS12625.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 3409286..3409625 11..349 99   Plus

BS12625.complete Sequence

365 bp assembled on 2006-11-01

> BS12625.complete
GAAGTTATCAGTCGACATGTCGGACTACTCAAAGTTTCTGTCCAACTTGA
CGGATCAGCTGGCACTTCTGCCTAAAGTTGCGCCCAAAGGATTGGGACGA
TTGGGCAGCCTGGAGAACTTGGGCAATAATCTGGGCAATCTGCGCCCCGC
CCACAAGGCTCTGATGTGCGTGGGCGTGGCCACTGTGGCTTGCGTTGTCC
TCGGCTTCACTGTTAAGTCATTAAAGGGACATAGCCGCAAGGACAAGCAA
AGGATCATCAATGTACGAATCGGTAATCCGATCAAGCGGGAACTCGAGGG
GGCTGATAAGGACGAAGGATCCTTTGGGAAGGAAGAAGAACTCAATTGAA
AGCTTTCTAGACCAT

BS12625.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13021-RB 333 CG13021-PB 1..333 17..349 1665 100 Plus
CG13021-RA 333 CG13021-PA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13021-RB 611 CG13021-RB 114..446 17..349 1665 100 Plus
CG13021-RA 597 CG13021-RA 100..432 17..349 1665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3515260..3515592 17..349 1665 100 Plus
Blast to na_te.dros performed 2014-11-26 15:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
diver2 4917 diver2 DIVER2 4917bp 2659..2709 20..68 105 72.5 Plus

BS12625.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:47:17 Download gff for BS12625.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RC 1..333 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:35:12 Download gff for BS12625.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RC 330..669 11..349 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:45:15 Download gff for BS12625.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 100..431 17..348 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:47:17 Download gff for BS12625.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RC 330..669 11..349 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:04:19 Download gff for BS12625.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 100..431 17..348 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:04:19 Download gff for BS12625.complete
Subject Subject Range Query Range Percent Splice Strand
X 3515260..3515591 17..348 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:45:15 Download gff for BS12625.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3409293..3409624 17..348 100   Plus

BS12625.pep Sequence

Translation from 16 to 348

> BS12625.pep
MSDYSKFLSNLTDQLALLPKVAPKGLGRLGSLENLGNNLGNLRPAHKALM
CVGVATVACVVLGFTVKSLKGHSRKDKQRIINVRIGNPIKRELEGADKDE
GSFGKEEELN*

BS12625.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 01:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13021-PB 110 CG13021-PB 1..110 1..110 560 100 Plus
CG13021-PA 110 CG13021-PA 1..110 1..110 560 100 Plus