Clone BS12660 Report

Search the DGRC for BS12660

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:126
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptOscp-RB
Protein status:BS12660.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12660.5prime Sequence

411 bp (411 high quality bases) assembled on 2006-10-13

> BS12660.5prime
GAAGTTATCAGTCGACATGGCCACCGCTCTGAAGGAGGCATCCGAGAAGC
TCCGCTTCGCCCCGGCCACCGTCAATCTGTTGGGTCTGCTGGCTGACAAC
GGACGTCTAAAGAAGCTGGACACCGTGATCAATGCCTACAAGACCATCAT
GGCCGCACATCGCGGTGAGGTCGTCTGCGAGGTGGTCACCGCCAAGCCCT
TGGATGCGTCCCAGAGCAAGCAGCTGGAGGGTGCCCTTAAGTCTTTCCTG
AAGGGCAACGAGTCTCTGAAGATCACTTCCCGCGTGGACCCCAGCATCAT
TGGTGGCCTGATCGTTTCCATTGGCGACAAGTACGTCGACATGAGCATTG
CCACTAAGGTCAAGCTCTACACCGATGTCATCCAGACCGCTGCCTAGAAG
CTTTCTAGACC

BS12660.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG4307-PA 630 Oscp-RA 249..630 16..397 1910 100 Plus
CG4307-PB 381 Oscp-RB 1..381 17..397 1905 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-RA 802 CG4307-RA 319..701 16..398 1915 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15266145..15266370 16..241 1130 100 Plus
3R 32079331 3R 15266431..15266589 240..398 795 100 Plus
Blast to na_te.dros performed on 2015-02-08 12:00:24 has no hits.

BS12660.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:06 Download gff for BS12660.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4307-PA 245..630 10..397 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:38:51 Download gff for BS12660.5prime
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 315..707 10..407 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:43:47 Download gff for BS12660.5prime
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 315..707 10..407 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:43:47 Download gff for BS12660.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 15266433..15266595 242..407 97   Plus
3R 15266141..15266370 10..241 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:38:51 Download gff for BS12660.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11091863..11092092 10..241 98 -> Plus
arm_3R 11092155..11092317 242..407 97   Plus

BS12660.3prime Sequence

411 bp (411 high quality bases) assembled on 2006-10-13

> BS12660.3prime
ATGGTCTAGAAAGCTTCTAGGCAGCGGTCTGGATGACATCGGTGTAGAGC
TTGACCTTAGTGGCAATGCTCATGTCGACGTACTTGTCGCCAATGGAAAC
GATCAGGCCACCAATGATGCTGGGGTCCACGCGGGAAGTGATCTTCAGAG
ACTCGTTGCCCTTCAGGAAAGACTTAAGGGCACCCTCCAGCTGCTTGCTC
TGGGACGCATCCAAGGGCTTGGCGGTGACCACCTCGCAGACGACCTCACC
GCGATGTGCGGCCATGATGGTCTTGTAGGCATTGATCACGGTGTCCAGCT
TCTTTAGACGTCCGTTGTCAGCCAGCAGACCCAACAGATTGACGGTGGCC
GGGGCGAAGCGGAGCTTCTCGGATGCCTCCTTCAGAGCGGTGGCCATGTC
GACTGATAACT

BS12660.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG4307-PA 630 Oscp-RA 249..630 398..17 1910 100 Minus
CG4307-PB 381 Oscp-RB 1..381 397..17 1905 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-RA 802 CG4307-RA 319..701 398..16 1915 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15266145..15266370 398..173 1130 100 Minus
3R 32079331 3R 15266431..15266589 174..16 795 100 Minus
Blast to na_te.dros performed on 2015-02-12 03:55:41 has no hits.

BS12660.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:05 Download gff for BS12660.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4307-PA 245..630 17..404 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:32:15 Download gff for BS12660.3prime
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 315..707 7..404 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:51:29 Download gff for BS12660.3prime
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 315..707 7..404 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:51:29 Download gff for BS12660.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 15266141..15266370 173..404 98 -> Minus
3R 15266433..15266595 7..172 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:32:15 Download gff for BS12660.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11092155..11092317 7..172 97   Minus
arm_3R 11091863..11092092 173..404 98 -> Minus

BS12660.complete Sequence

413 bp assembled on 2006-11-01

GenBank Submission: FJ637256

> BS12660.complete
GAAGTTATCAGTCGACATGGCCACCGCTCTGAAGGAGGCATCCGAGAAGC
TCCGCTTCGCCCCGGCCACCGTCAATCTGTTGGGTCTGCTGGCTGACAAC
GGACGTCTAAAGAAGCTGGACACCGTGATCAATGCCTACAAGACCATCAT
GGCCGCACATCGCGGTGAGGTCGTCTGCGAGGTGGTCACCGCCAAGCCCT
TGGATGCGTCCCAGAGCAAGCAGCTGGAGGGTGCCCTTAAGTCTTTCCTG
AAGGGCAACGAGTCTCTGAAGATCACTTCCCGCGTGGACCCCAGCATCAT
TGGTGGCCTGATCGTTTCCATTGGCGACAAGTACGTCGACATGAGCATTG
CCACTAAGGTCAAGCTCTACACCGATGTCATCCAGACCGCTGCCTAGAAG
CTTTCTAGACCAT

BS12660.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-RA 630 CG4307-PA 249..630 16..397 1910 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-RA 802 CG4307-RA 319..701 16..398 1915 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15266145..15266370 16..241 1130 100 Plus
3R 32079331 3R 15266431..15266589 240..398 795 100 Plus
Blast to na_te.dros performed on 2014-11-28 01:10:36 has no hits.

BS12660.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:05 Download gff for BS12660.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 245..630 10..397 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:11:50 Download gff for BS12660.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RB 375..767 10..407 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:41:11 Download gff for BS12660.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 320..700 17..397 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:05 Download gff for BS12660.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RB 375..767 10..407 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:46:33 Download gff for BS12660.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 320..700 17..397 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:46:33 Download gff for BS12660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15266146..15266370 17..241 100 -> Plus
3R 15266433..15266588 242..397 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:41:11 Download gff for BS12660.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11091868..11092092 17..241 100 -> Plus
arm_3R 11092155..11092310 242..397 100   Plus

BS12660.pep Sequence

Translation from 16 to 396

> BS12660.pep
MATALKEASEKLRFAPATVNLLGLLADNGRLKKLDTVINAYKTIMAAHRG
EVVCEVVTAKPLDASQSKQLEGALKSFLKGNESLKITSRVDPSIIGGLIV
SIGDKYVDMSIATKVKLYTDVIQTAA*

BS12660.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-PA 209 CG4307-PA 84..209 1..126 611 100 Plus