Clone BS12669 Report

Search the DGRC for BS12669

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:126
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptCG30192-RA
Protein status:BS12669.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12669.complete Sequence

245 bp assembled on 2006-11-01

GenBank Submission: FJ637260

> BS12669.complete
GAAGTTATCAGTCGACATGGCGGATCCGAGTATCAATGACATCGATGAGA
CTGTGGCTCCTCCCCTCGGAGGCGCTGACAGCTTCGACCTGAACAAGCGG
CTAGATTGCGAGCATTTAGATCAGATGACGGATAATTGGACCGATTATCA
AAGACCCTCGTTTGCCACCGAACTTCTGCGATTTTTCGGCAACGTATTTG
TCGATATATTTAATGCGATTTTCAACTGAAAGCTTTCTAGACCAT

BS12669.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-RA 213 CG30192-PA 1..213 17..229 1065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-RA 373 CG30192-RA 86..299 16..229 1070 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23138674..23138777 16..119 520 100 Plus
2R 25286936 2R 23138842..23138924 118..200 415 100 Plus
Blast to na_te.dros performed 2014-11-27 06:52:07
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 3970..4004 151..185 112 80 Plus

BS12669.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:55:37 Download gff for BS12669.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 1..213 17..229 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:05:43 Download gff for BS12669.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 91..311 8..234 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:01 Download gff for BS12669.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 87..298 17..228 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:55:37 Download gff for BS12669.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 91..311 8..234 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:56:35 Download gff for BS12669.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 87..298 17..228 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:56:35 Download gff for BS12669.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23138675..23138777 17..119 100 -> Plus
2R 23138844..23138924 120..200 100 -> Plus
2R 23138983..23139010 201..228 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:01 Download gff for BS12669.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19026198..19026300 17..119 100 -> Plus
arm_2R 19026367..19026447 120..200 100 -> Plus
arm_2R 19026506..19026533 201..228 100   Plus

BS12669.3prime Sequence

243 bp (243 high quality bases) assembled on 2006-10-13

> BS12669.3prime
ATGGTCTAGAAAGCTTTCAGTTGAAAATCGCATTAAATATATCGACAAAT
ACGTTGCCGAAAAATCGCAGAAGTTCGGTGGCAAACGAGGGTCTTTGATA
ATCGGTCCAATTATCCGTCATCTGATCTAAATGCTCGCAATCTAGCCGCT
TGTTCAGGTCGAAGCTGTCAGCGCCTCCGAGGGGAGGAGCCACAGTCTCA
TCGATGTCATTGATACTCGGATCCGCCATGTCGACTGATAACT

BS12669.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-PA 213 CG30192-RA 1..213 229..17 1065 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-RA 373 CG30192-RA 86..299 230..17 1070 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23138674..23138777 230..127 520 100 Minus
2R 25286936 2R 23138842..23138924 128..46 415 100 Minus
Blast to na_te.dros performed 2015-02-10 16:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 3970..4004 95..61 112 80 Minus

BS12669.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:13 Download gff for BS12669.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-PA 1..213 17..229 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:12:12 Download gff for BS12669.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 82..302 12..238 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:45:22 Download gff for BS12669.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 82..302 12..238 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:45:22 Download gff for BS12669.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 23138670..23138777 127..238 96 -> Minus
2R 23138844..23138924 46..126 100 -> Minus
2R 23138983..23139014 12..45 91   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:12:12 Download gff for BS12669.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19026193..19026300 127..238 96 -> Minus
arm_2R 19026367..19026447 46..126 100 -> Minus
arm_2R 19026506..19026537 12..45 91   Minus

BS12669.5prime Sequence

243 bp (243 high quality bases) assembled on 2006-10-13

> BS12669.5prime
GAAGTTATCAGTCGACATGGCGGATCCGAGTATCAATGACATCGATGAGA
CTGTGGCTCCTCCCCTCGGAGGCGCTGACAGCTTCGACCTGAACAAGCGG
CTAGATTGCGAGCATTTAGATCAGATGACGGATAATTGGACCGATTATCA
AAGACCCTCGTTTGCCACCGAACTTCTGCGATTTTTCGGCAACGTATTTG
TCGATATATTTAATGCGATTTTCAACTGAAAGCTTTCTAGACC

BS12669.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-PA 213 CG30192-RA 1..213 17..229 1065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-RA 373 CG30192-RA 86..299 16..229 1070 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 17:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23138674..23138777 16..119 520 100 Plus
2R 25286936 2R 23138842..23138924 118..200 415 100 Plus
Blast to na_te.dros performed 2015-01-30 17:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 3970..4004 151..185 112 80 Plus

BS12669.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:13 Download gff for BS12669.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-PA 1..213 17..229 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 18:51:29 Download gff for BS12669.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 82..302 8..234 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 20:06:03 Download gff for BS12669.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 82..302 8..234 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 20:06:03 Download gff for BS12669.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 23138670..23138777 8..119 96 -> Plus
2R 23138844..23138924 120..200 100 -> Plus
2R 23138983..23139014 201..234 91   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 18:51:29 Download gff for BS12669.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19026193..19026300 8..119 96 -> Plus
arm_2R 19026367..19026447 120..200 100 -> Plus
arm_2R 19026506..19026537 201..234 91   Plus

BS12669.pep Sequence

Translation from 16 to 228

> BS12669.pep
MADPSINDIDETVAPPLGGADSFDLNKRLDCEHLDQMTDNWTDYQRPSFA
TELLRFFGNVFVDIFNAIFN*

BS12669.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-PA 70 CG30192-PA 1..70 1..70 378 100 Plus