Clone BS12670 Report

Search the DGRC for BS12670

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:126
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptTom7-RA
Protein status:BS12670.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12670.3prime Sequence

195 bp (195 high quality bases) assembled on 2006-10-13

> BS12670.3prime
ATGGTCTAGAAAGCTTTTACTGCCATAACAGACTGAAAAGGTTCAGAGGC
GGCATGCCAGGCTCAGCTCCCTTCATAAATCCCAAATACAGCACAAGAGG
CACGAATCCCCAGTGGAATCCAGTCTGGACGACTCCAACCACAAATCCCA
AACGATCCTTAACTCCCTCGGATAGCTTCATGTCGACTGATAACT

BS12670.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 20:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG8226-PA 165 Tom7-RA 1..165 181..17 825 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-RB 539 CG8226-RB 195..365 185..15 840 99.4 Minus
Tom7-RA 355 CG8226-RA 73..243 185..15 840 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8951789..8951893 185..81 510 99 Minus
2R 25286936 2R 8952001..8952068 82..15 340 100 Minus
Blast to na_te.dros performed on 2015-02-12 11:33:53 has no hits.

BS12670.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:14 Download gff for BS12670.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8226-PA 1..165 17..181 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 21:38:05 Download gff for BS12670.3prime
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 63..243 15..195 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:41:35 Download gff for BS12670.3prime
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 63..243 15..195 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:41:35 Download gff for BS12670.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 8951779..8951892 82..195 95 -> Minus
2R 8952002..8952068 15..81 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 21:38:05 Download gff for BS12670.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4839284..4839397 82..195 95 -> Minus
arm_2R 4839507..4839573 15..81 100   Minus

BS12670.5prime Sequence

195 bp (195 high quality bases) assembled on 2006-10-13

> BS12670.5prime
GAAGTTATCAGTCGACATGAAGCTATCCGAGGGAGTTAAGGATCGTTTGG
GATTTGTGGTTGGAGTCGTCCAGACTGGATTCCACTGGGGATTCGTGCCT
CTTGTGCTGTATTTGGGATTTATGAAGGGAGCTGAGCCTGGCATGCCGCC
TCTGAACCTTTTCAGTCTGTTATGGCAGTAAAAGCTTTCTAGACC

BS12670.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 20:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8226-PA 165 Tom7-RA 1..165 17..181 825 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:27:05
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-RB 539 CG8226-RB 195..365 13..183 840 99.4 Plus
Tom7-RA 355 CG8226-RA 73..243 13..183 840 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8951789..8951893 13..117 510 99 Plus
2R 25286936 2R 8952001..8952068 116..183 340 100 Plus
Blast to na_te.dros performed on 2015-02-12 16:27:04 has no hits.

BS12670.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:15 Download gff for BS12670.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8226-PA 1..165 17..181 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 17:06:03 Download gff for BS12670.5prime
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 63..243 2..183 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:29:32 Download gff for BS12670.5prime
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 63..243 2..183 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:29:32 Download gff for BS12670.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 8951779..8951892 2..116 95 -> Plus
2R 8952002..8952068 117..183 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 17:06:03 Download gff for BS12670.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4839284..4839397 2..116 95 -> Plus
arm_2R 4839507..4839573 117..183 100   Plus

BS12670.complete Sequence

197 bp assembled on 2007-12-19

GenBank Submission: FJ637261

> BS12670.complete
GAAGTTATCAGTCGACATGAAGCTATCCGAGGGAGTTAAGGATCGTTTGG
GATTTGTGGTTGGAGTCGTCCAGACTGGATTCCACTGGGGATTCGTGCCT
CTTGTGCTGTATTTGGGATTTATGAAGGGAGCTGAGCCTGGCATGCCGCC
TCTGAACCTTTTCAGTCTGTTATGGCAGTAAAAGCTTTCTAGACCAT

BS12670.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-RB 165 CG8226-PB 1..165 17..181 825 100 Plus
Tom7-RA 165 CG8226-PA 1..165 17..181 825 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-RB 539 CG8226-RB 195..365 13..183 840 99.4 Plus
Tom7-RA 355 CG8226-RA 73..243 13..183 840 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8951789..8951893 13..117 510 99 Plus
2R 25286936 2R 8952001..8952068 116..183 340 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:27:10 has no hits.

BS12670.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:15:20 Download gff for BS12670.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 1..165 17..181 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 15:33:58 Download gff for BS12670.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 106..268 17..179 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:31 Download gff for BS12670.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 77..239 17..179 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:15:20 Download gff for BS12670.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 92..272 2..183 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:11:55 Download gff for BS12670.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 77..239 17..179 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:11:55 Download gff for BS12670.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8952002..8952064 117..179 100   Plus
2R 8951793..8951892 17..116 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:31 Download gff for BS12670.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4839507..4839569 117..179 100   Plus
arm_2R 4839298..4839397 17..116 100 -> Plus

BS12670.pep Sequence

Translation from 16 to 180

> BS12670.pep
MKLSEGVKDRLGFVVGVVQTGFHWGFVPLVLYLGFMKGAEPGMPPLNLFS
LLWQ*

BS12670.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-PB 54 CG8226-PB 1..54 1..54 291 100 Plus
Tom7-PA 54 CG8226-PA 1..54 1..54 291 100 Plus