Clone BS12671 Report

Search the DGRC for BS12671

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:126
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG31226-RA
Protein status:BS12671.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12671.5prime Sequence

189 bp (189 high quality bases) assembled on 2006-10-13

> BS12671.5prime
GAAGTTATCAGTCGACATGTGCAGCTATCCTTGCTATCCTTGCGCCGCCT
TGTGTCCCTGCGGAGGCAGTGGACCAAGTGGATTCTACGATCCGTGCTTT
GGACCCTACAACGGACCATTTAACTCCTGGTGCGGAGCAAGTGGACCCGG
TTTCTGGAGAGGTGGATGTTGCTAGAAGCTTTCTAGACC

BS12671.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 20:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG31226-PA 159 CG31226-RA 1..159 17..175 795 100 Plus
CG31226-PB 159 CG31226-RB 1..159 17..175 795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG31226-RB 384 CG31226-RB 91..250 16..175 800 100 Plus
CG31226-RA 389 CG31226-RA 96..255 16..175 800 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18851492..18851651 175..16 800 100 Minus
Blast to na_te.dros performed on 2015-02-10 18:18:26 has no hits.

BS12671.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:16 Download gff for BS12671.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31226-PB 1..159 17..175 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 06:50:08 Download gff for BS12671.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 86..258 7..182 95   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:37:18 Download gff for BS12671.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 86..258 7..182 95   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:37:18 Download gff for BS12671.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 18851487..18851661 7..182 95   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 06:50:08 Download gff for BS12671.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14677209..14677383 7..182 95   Minus

BS12671.3prime Sequence

189 bp (189 high quality bases) assembled on 2006-10-13

> BS12671.3prime
ATGGTCTAGAAAGCTTCTAGCAACATCCACCTCTCCAGAAACCGGGTCCA
CTTGCTCCGCACCAGGAGTTAAATGGTCCGTTGTAGGGTCCAAAGCACGG
ATCGTAGAATCCACTTGGTCCACTGCCTCCGCAGGGACACAAGGCGGCGC
AAGGATAGCAAGGATAGCTGCACATGTCGACTGATAACT

BS12671.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 20:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31226-PA 159 CG31226-RA 1..159 175..17 795 100 Minus
CG31226-PB 159 CG31226-RB 1..159 175..17 795 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG31226-RB 384 CG31226-RB 91..250 176..17 800 100 Minus
CG31226-RA 389 CG31226-RA 96..255 176..17 800 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 07:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18851492..18851651 17..176 800 100 Plus
Blast to na_te.dros performed on 2015-02-12 07:13:14 has no hits.

BS12671.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:15 Download gff for BS12671.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31226-PB 1..159 17..175 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 07:14:29 Download gff for BS12671.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 86..258 10..185 95   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:15:26 Download gff for BS12671.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 86..258 10..185 95   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 11:15:26 Download gff for BS12671.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 18851487..18851661 10..185 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 07:14:29 Download gff for BS12671.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14677209..14677383 10..185 95   Plus

BS12671.complete Sequence

191 bp assembled on 2007-12-19

GenBank Submission: FJ637262

> BS12671.complete
GAAGTTATCAGTCGACATGTGCAGCTATCCTTGCTATCCTTGCGCCGCCT
TGTGTCCCTGCGGAGGCAGTGGACCAAGTGGATTCTACGATCCGTGCTTT
GGACCCTACAACGGACCATTTAACTCCTGGTGCGGAGCAAGTGGACCCGG
TTTCTGGAGAGGTGGATGTTGCTAGAAGCTTTCTAGACCAT

BS12671.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31226-RB 159 CG31226-PB 1..159 17..175 795 100 Plus
CG31226-RA 159 CG31226-PA 1..159 17..175 795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG31226-RB 384 CG31226-RB 91..250 16..175 800 100 Plus
CG31226-RA 389 CG31226-RA 96..255 16..175 800 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18851492..18851651 175..16 800 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:05:34 has no hits.

BS12671.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:15:21 Download gff for BS12671.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RB 1..159 17..175 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 15:30:56 Download gff for BS12671.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 103..261 17..175 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:52:40 Download gff for BS12671.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 97..255 17..175 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:15:21 Download gff for BS12671.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 92..264 7..182 95   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:10:44 Download gff for BS12671.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 97..255 17..175 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:10:44 Download gff for BS12671.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18851492..18851650 17..175 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:52:40 Download gff for BS12671.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14677214..14677372 17..175 100   Minus

BS12671.pep Sequence

Translation from 16 to 174

> BS12671.pep
MCSYPCYPCAALCPCGGSGPSGFYDPCFGPYNGPFNSWCGASGPGFWRGG
CC*

BS12671.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG31226-PB 52 CG31226-PB 1..52 1..52 341 100 Plus
CG31226-PA 52 CG31226-PA 1..52 1..52 341 100 Plus