Clone Sequence Records
BS12673.5prime Sequence
273 bp (273 high quality bases) assembled on 2006-10-13
> BS12673.5prime
GAAGTTATCAGTCGACATGTCGTGCAATCGTTCTTTTGGACCTGGCCCTG
GTGCCTACAATCTGCCCAGCACCTTTGGGTTTAAGAACTGCGACAAGAGG
ATGCAGCGAAGTCCACAGTTCTCATTTGGCAGATCGTCGAGGGCGTGTAA
TAGTCCTAGGATACCGCAGGGACCCGGCCCAGCAGATTATCATGTGGGCA
AAATAACGCGATATGGACGTCCTGCATCGGAGGACTTCAATGTTTATCGT
CGTCGCTAAAAGCTTTCTAGACC
BS12673.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-PA | 243 | CG31468-RA | 1..243 | 17..259 | 1215 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:18:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-RB | 967 | CG31468-RB | 153..396 | 16..259 | 1220 | 100 | Plus |
CG31468-RA | 447 | CG31468-RA | 153..396 | 16..259 | 1220 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:18:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23699899..23700124 | 259..34 | 1115 | 99.6 | Minus |
Blast to na_te.dros performed on 2015-02-10 16:18:11 has no hits.
BS12673.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:17 Download gff for
BS12673.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-PA | 1..243 | 17..259 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:12:30 Download gff for
BS12673.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..402 | 16..265 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:45:45 Download gff for
BS12673.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..402 | 16..265 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:45:45 Download gff for
BS12673.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23699893..23700119 | 39..265 | 98 | <- | Minus |
3R | 23700180..23700202 | 16..38 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:12:30 Download gff for
BS12673.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19525615..19525841 | 39..265 | 98 | <- | Minus |
arm_3R | 19525902..19525924 | 16..38 | 100 | | Minus |
BS12673.3prime Sequence
273 bp (273 high quality bases) assembled on 2006-10-13
> BS12673.3prime
ATGGTCTAGAAAGCTTTTAGCGACGACGATAAACATTGAAGTCCTCCGAT
GCAGGACGTCCATATCGCGTTATTTTGCCCACATGATAATCTGCTGGGCC
GGGTCCCTGCGGTATCCTAGGACTATTACACGCCCTCGACGATCTGCCAA
ATGAGAACTGTGGACTTCGCTGCATCCTCTTGTCGCAGTTCTTAAACCCA
AAGGTGCTGGGCAGATTGTAGGCACCAGGGCCAGGTCCAAAAGAACGATT
GCACGACATGTCGACTGATAACT
BS12673.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-PA | 243 | CG31468-RA | 1..243 | 259..17 | 1215 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:47:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-RB | 967 | CG31468-RB | 153..396 | 260..17 | 1220 | 100 | Minus |
CG31468-RA | 447 | CG31468-RA | 153..396 | 260..17 | 1220 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:47:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23699899..23700124 | 17..242 | 1115 | 99.6 | Plus |
Blast to na_te.dros performed on 2015-02-12 17:47:52 has no hits.
BS12673.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:17 Download gff for
BS12673.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-PA | 1..243 | 17..259 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:42:28 Download gff for
BS12673.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..402 | 11..260 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:47:43 Download gff for
BS12673.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..402 | 11..260 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:47:43 Download gff for
BS12673.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23699893..23700119 | 11..237 | 98 | <- | Plus |
3R | 23700180..23700202 | 238..260 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:42:28 Download gff for
BS12673.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19525615..19525841 | 11..237 | 98 | <- | Plus |
arm_3R | 19525902..19525924 | 238..260 | 100 | | Plus |
BS12673.complete Sequence
275 bp assembled on 2006-11-01
GenBank Submission: FJ637264
> BS12673.complete
GAAGTTATCAGTCGACATGTCGTGCAATCGTTCTTTTGGACCTGGCCCTG
GTGCCTACAATCTGCCCAGCACCTTTGGGTTTAAGAACTGCGACAAGAGG
ATGCAGCGAAGTCCACAGTTCTCATTTGGCAGATCGTCGAGGGCGTGTAA
TAGTCCTAGGATACCGCAGGGACCCGGCCCAGCAGATTATCATGTGGGCA
AAATAACGCGATATGGACGTCCTGCATCGGAGGACTTCAATGTTTATCGT
CGTCGCTAAAAGCTTTCTAGACCAT
BS12673.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:26:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-RB | 243 | CG31468-PB | 1..243 | 17..259 | 1215 | 100 | Plus |
CG31468-RA | 243 | CG31468-PA | 1..243 | 17..259 | 1215 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:26:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-RB | 967 | CG31468-RB | 153..396 | 16..259 | 1220 | 100 | Plus |
CG31468-RA | 447 | CG31468-RA | 153..396 | 16..259 | 1220 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:26:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23699899..23700124 | 259..34 | 1115 | 99.6 | Minus |
Blast to na_te.dros performed on 2014-11-27 08:26:50 has no hits.
BS12673.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:43:26 Download gff for
BS12673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 1..243 | 17..259 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:17:45 Download gff for
BS12673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..402 | 16..265 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:31:25 Download gff for
BS12673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 154..394 | 17..257 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:43:26 Download gff for
BS12673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..402 | 16..265 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:18:56 Download gff for
BS12673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 154..394 | 17..257 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:18:56 Download gff for
BS12673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23699901..23700119 | 39..257 | 100 | <- | Minus |
3R | 23700180..23700201 | 17..38 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:31:25 Download gff for
BS12673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19525623..19525841 | 39..257 | 100 | <- | Minus |
arm_3R | 19525902..19525923 | 17..38 | 100 | | Minus |
BS12673.pep Sequence
Translation from 16 to 258
> BS12673.pep
MSCNRSFGPGPGAYNLPSTFGFKNCDKRMQRSPQFSFGRSSRACNSPRIP
QGPGPADYHVGKITRYGRPASEDFNVYRRR*
BS12673.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-PB | 80 | CG31468-PB | 1..80 | 1..80 | 446 | 100 | Plus |
CG31468-PA | 80 | CG31468-PA | 1..80 | 1..80 | 446 | 100 | Plus |
CG10252-PA | 229 | CG10252-PA | 4..75 | 5..79 | 176 | 49.3 | Plus |
CG31870-PD | 79 | CG31870-PD | 2..67 | 4..79 | 167 | 48.7 | Plus |
CG31870-PA | 79 | CG31870-PA | 2..67 | 4..79 | 167 | 48.7 | Plus |