Clone BS12673 Report

Search the DGRC for BS12673

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:126
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG31468-RA
Protein status:BS12673.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12673.5prime Sequence

273 bp (273 high quality bases) assembled on 2006-10-13

> BS12673.5prime
GAAGTTATCAGTCGACATGTCGTGCAATCGTTCTTTTGGACCTGGCCCTG
GTGCCTACAATCTGCCCAGCACCTTTGGGTTTAAGAACTGCGACAAGAGG
ATGCAGCGAAGTCCACAGTTCTCATTTGGCAGATCGTCGAGGGCGTGTAA
TAGTCCTAGGATACCGCAGGGACCCGGCCCAGCAGATTATCATGTGGGCA
AAATAACGCGATATGGACGTCCTGCATCGGAGGACTTCAATGTTTATCGT
CGTCGCTAAAAGCTTTCTAGACC

BS12673.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-PA 243 CG31468-RA 1..243 17..259 1215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-RB 967 CG31468-RB 153..396 16..259 1220 100 Plus
CG31468-RA 447 CG31468-RA 153..396 16..259 1220 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23699899..23700124 259..34 1115 99.6 Minus
Blast to na_te.dros performed on 2015-02-10 16:18:11 has no hits.

BS12673.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:17 Download gff for BS12673.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-PA 1..243 17..259 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:12:30 Download gff for BS12673.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..402 16..265 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:45:45 Download gff for BS12673.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..402 16..265 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:45:45 Download gff for BS12673.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 23699893..23700119 39..265 98 <- Minus
3R 23700180..23700202 16..38 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:12:30 Download gff for BS12673.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19525615..19525841 39..265 98 <- Minus
arm_3R 19525902..19525924 16..38 100   Minus

BS12673.3prime Sequence

273 bp (273 high quality bases) assembled on 2006-10-13

> BS12673.3prime
ATGGTCTAGAAAGCTTTTAGCGACGACGATAAACATTGAAGTCCTCCGAT
GCAGGACGTCCATATCGCGTTATTTTGCCCACATGATAATCTGCTGGGCC
GGGTCCCTGCGGTATCCTAGGACTATTACACGCCCTCGACGATCTGCCAA
ATGAGAACTGTGGACTTCGCTGCATCCTCTTGTCGCAGTTCTTAAACCCA
AAGGTGCTGGGCAGATTGTAGGCACCAGGGCCAGGTCCAAAAGAACGATT
GCACGACATGTCGACTGATAACT

BS12673.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-PA 243 CG31468-RA 1..243 259..17 1215 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-RB 967 CG31468-RB 153..396 260..17 1220 100 Minus
CG31468-RA 447 CG31468-RA 153..396 260..17 1220 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23699899..23700124 17..242 1115 99.6 Plus
Blast to na_te.dros performed on 2015-02-12 17:47:52 has no hits.

BS12673.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:17 Download gff for BS12673.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-PA 1..243 17..259 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:42:28 Download gff for BS12673.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..402 11..260 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:47:43 Download gff for BS12673.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..402 11..260 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:47:43 Download gff for BS12673.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 23699893..23700119 11..237 98 <- Plus
3R 23700180..23700202 238..260 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:42:28 Download gff for BS12673.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19525615..19525841 11..237 98 <- Plus
arm_3R 19525902..19525924 238..260 100   Plus

BS12673.complete Sequence

275 bp assembled on 2006-11-01

GenBank Submission: FJ637264

> BS12673.complete
GAAGTTATCAGTCGACATGTCGTGCAATCGTTCTTTTGGACCTGGCCCTG
GTGCCTACAATCTGCCCAGCACCTTTGGGTTTAAGAACTGCGACAAGAGG
ATGCAGCGAAGTCCACAGTTCTCATTTGGCAGATCGTCGAGGGCGTGTAA
TAGTCCTAGGATACCGCAGGGACCCGGCCCAGCAGATTATCATGTGGGCA
AAATAACGCGATATGGACGTCCTGCATCGGAGGACTTCAATGTTTATCGT
CGTCGCTAAAAGCTTTCTAGACCAT

BS12673.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-RB 243 CG31468-PB 1..243 17..259 1215 100 Plus
CG31468-RA 243 CG31468-PA 1..243 17..259 1215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-RB 967 CG31468-RB 153..396 16..259 1220 100 Plus
CG31468-RA 447 CG31468-RA 153..396 16..259 1220 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23699899..23700124 259..34 1115 99.6 Minus
Blast to na_te.dros performed on 2014-11-27 08:26:50 has no hits.

BS12673.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:43:26 Download gff for BS12673.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..243 17..259 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:17:45 Download gff for BS12673.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..402 16..265 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:31:25 Download gff for BS12673.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 154..394 17..257 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:43:26 Download gff for BS12673.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..402 16..265 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:18:56 Download gff for BS12673.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 154..394 17..257 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:18:56 Download gff for BS12673.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23699901..23700119 39..257 100 <- Minus
3R 23700180..23700201 17..38 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:31:25 Download gff for BS12673.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19525623..19525841 39..257 100 <- Minus
arm_3R 19525902..19525923 17..38 100   Minus

BS12673.pep Sequence

Translation from 16 to 258

> BS12673.pep
MSCNRSFGPGPGAYNLPSTFGFKNCDKRMQRSPQFSFGRSSRACNSPRIP
QGPGPADYHVGKITRYGRPASEDFNVYRRR*

BS12673.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-PB 80 CG31468-PB 1..80 1..80 446 100 Plus
CG31468-PA 80 CG31468-PA 1..80 1..80 446 100 Plus
CG10252-PA 229 CG10252-PA 4..75 5..79 176 49.3 Plus
CG31870-PD 79 CG31870-PD 2..67 4..79 167 48.7 Plus
CG31870-PA 79 CG31870-PA 2..67 4..79 167 48.7 Plus