Clone Sequence Records
BS12677.5prime Sequence
294 bp (294 high quality bases) assembled on 2006-10-13
> BS12677.5prime
GAAGTTATCAGTCGACATGGGTATGAAACGCTTTGTATCCTCTTTGATTC
GCAAGTCCCCGATCAGTCCGTCGGAGCCTGGAAAATTGGCTGCCGGTTGC
CCAGCCGTGTTCGCCCAAGACGGCACGTGGAGTGCCAAGTTCAATGGTCA
GTTCGCTCCGGAGAAGATTAACGATCAGGTGATCAAGCAAGAGTCCGGCC
GCAAGGACGACGATTTAACTTCCACAATTCGACTCCCACGCAAACGTTCT
TGGCTACAGAGGCGTGTGATTCCCGTGTAGAAGCTTTCTAGACC
BS12677.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:45
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG16741-PA | 264 | CG16741-RA | 1..260 | 17..276 | 1275 | 99.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:30:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG16741-RA | 549 | CG16741-RA | 91..355 | 17..281 | 1295 | 99.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:30:33
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 20347131..20347395 | 17..281 | 1295 | 99.2 | Plus |
Blast to na_te.dros performed on 2015-02-10 21:30:36 has no hits.
BS12677.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:20 Download gff for
BS12677.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG16741-PA | 1..264 | 17..280 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:06:29 Download gff for
BS12677.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG16741-RA | 91..362 | 17..289 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:42:33 Download gff for
BS12677.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG16741-RA | 91..362 | 17..289 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:42:33 Download gff for
BS12677.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 20347131..20347402 | 17..289 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:06:29 Download gff for
BS12677.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 16234636..16234907 | 17..289 | 97 | | Plus |
BS12677.complete Sequence
296 bp assembled on 2006-11-01
GenBank Submission: FJ637266
> BS12677.complete
GAAGTTATCAGTCGACATGGGTATGAAACGCTTTGTATCCTCTTTGATTC
GCAAGTCCCCGATCAGTCCGTCGGAGCCTGGAAAATTGGCTGCCGGTTGC
CCAGCCGTGTTCGCCCAAGACGGCACGTGGAGTGCCAAGTTCAATGGTCA
GTTCGCTCCGGAGAAGATTAACGATCAGGTGATCAAGCAAGAGTCCGGCC
GCAAGGACGACGATTTAACTTCCACAATTCGACTCCCACGCAAACGTTCT
TGGCTACAGAGGCGTGTGATTCCCGTGTAGAAGCTTTCTAGACCAT
BS12677.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:16:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG16741-RA | 264 | CG16741-PA | 1..264 | 17..280 | 1290 | 99.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:16:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG16741-RA | 549 | CG16741-RA | 91..355 | 17..281 | 1295 | 99.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:16:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 20347131..20347395 | 17..281 | 1295 | 99.2 | Plus |
Blast to na_te.dros performed on 2014-11-26 22:16:03 has no hits.
BS12677.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:43:28 Download gff for
BS12677.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG16741-RA | 1..264 | 17..280 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:17:48 Download gff for
BS12677.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG16741-RA | 96..367 | 17..289 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:52:22 Download gff for
BS12677.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG16741-RA | 91..354 | 17..280 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:43:28 Download gff for
BS12677.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG16741-RA | 96..367 | 17..289 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:56:00 Download gff for
BS12677.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG16741-RA | 91..354 | 17..280 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:56:00 Download gff for
BS12677.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 20347131..20347394 | 17..280 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:52:22 Download gff for
BS12677.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 16234636..16234899 | 17..280 | 99 | | Plus |
BS12677.pep Sequence
Translation from 16 to 279
> BS12677.pep
MGMKRFVSSLIRKSPISPSEPGKLAAGCPAVFAQDGTWSAKFNGQFAPEK
INDQVIKQESGRKDDDLTSTIRLPRKRSWLQRRVIPV*
BS12677.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:45
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG16741-PA | 87 | CG16741-PA | 1..87 | 1..87 | 451 | 100 | Plus |
