Clone Sequence Records
BS12679.3prime Sequence
216 bp (216 high quality bases) assembled on 2006-10-13
> BS12679.3prime
ATGGTCTAGAAAGCTTTCACCAGCCGCAAGGACACGAGCTGCAGCCACCA
CAAGGACCACATGGACCACAGCAAGGACTACAGCAACCTCCACAGGGACC
ACATCCGCAATAGGGAGTTCCTCCCATCAAAGGAGCCAGGCAGCCGGGTG
GGCAGGGTCCAACGTAGAAGGGATCGAAGCTGCAGCAAAGCATCAGAACC
ATGTCGACTGATAACT
BS12679.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-PA | 186 | CG31740-RA | 1..186 | 202..17 | 930 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 18:08:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-RA | 606 | CG31740-RA | 220..406 | 202..16 | 935 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 18:08:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18009308..18009494 | 202..16 | 935 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-02 18:08:36 has no hits.
BS12679.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:20 Download gff for
BS12679.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-PA | 1..186 | 17..202 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 15:41:34 Download gff for
BS12679.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 215..408 | 13..207 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:13:48 Download gff for
BS12679.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 215..408 | 13..207 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:13:48 Download gff for
BS12679.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18009303..18009496 | 13..207 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:41:34 Download gff for
BS12679.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18009303..18009496 | 13..207 | 98 | | Minus |
BS12679.5prime Sequence
216 bp (216 high quality bases) assembled on 2006-10-13
> BS12679.5prime
GAAGTTATCAGTCGACATGGTTCTGATGCTTTGCTGCAGCTTCGATCCCT
TCTACGTTGGACCCTGCCCACCCGGCTGCCTGGCTCCTTTGATGGGAGGA
ACTCCCTATTGCGGATGTGGTCCCTGTGGAGGTTGCTGTAGTCCTTGCTG
TGGTCCATGTGGTCCTTGTGGTGGCTGCAGCTCGTGTCCTTGCGGCTGGT
GAAAGCTTTCTAGACC
BS12679.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-PA | 186 | CG31740-RA | 1..186 | 17..202 | 930 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:03:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-RA | 606 | CG31740-RA | 220..406 | 17..203 | 935 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:03:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18009308..18009494 | 17..203 | 935 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 21:03:27 has no hits.
BS12679.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:21 Download gff for
BS12679.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-PA | 1..186 | 17..202 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:24:49 Download gff for
BS12679.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 215..408 | 12..206 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:48:10 Download gff for
BS12679.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 215..408 | 12..206 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:48:10 Download gff for
BS12679.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18009303..18009496 | 12..206 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:24:49 Download gff for
BS12679.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18009303..18009496 | 12..206 | 98 | | Plus |
BS12679.complete Sequence
218 bp assembled on 2006-11-01
GenBank Submission: FJ637267
> BS12679.complete
GAAGTTATCAGTCGACATGGTTCTGATGCTTTGCTGCAGCTTCGATCCCT
TCTACGTTGGACCCTGCCCACCCGGCTGCCTGGCTCCTTTGATGGGAGGA
ACTCCCTATTGCGGATGTGGTCCCTGTGGAGGTTGCTGTAGTCCTTGCTG
TGGTCCATGTGGTCCTTGTGGTGGCTGCAGCTCGTGTCCTTGCGGCTGGT
GAAAGCTTTCTAGACCAT
BS12679.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:31:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-RA | 186 | CG31740-PA | 1..186 | 17..202 | 930 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:31:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-RA | 606 | CG31740-RA | 220..406 | 17..203 | 935 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:31:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18009308..18009494 | 17..203 | 935 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:31:20 has no hits.
BS12679.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:43:29 Download gff for
BS12679.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 1..186 | 17..202 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:17:50 Download gff for
BS12679.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 240..433 | 12..206 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:03:00 Download gff for
BS12679.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 220..404 | 17..201 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:43:30 Download gff for
BS12679.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 240..433 | 12..206 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:21:09 Download gff for
BS12679.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 220..404 | 17..201 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:21:09 Download gff for
BS12679.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18009308..18009492 | 17..201 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:03:00 Download gff for
BS12679.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18009308..18009492 | 17..201 | 100 | | Plus |
BS12679.pep Sequence
Translation from 16 to 201
> BS12679.pep
MVLMLCCSFDPFYVGPCPPGCLAPLMGGTPYCGCGPCGGCCSPCCGPCGP
CGGCSSCPCGW*
BS12679.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-PA | 61 | CG31740-PA | 1..61 | 1..61 | 406 | 100 | Plus |
Mst87F-PB | 56 | CG17956-PB | 1..53 | 5..61 | 152 | 49.2 | Plus |
Mst87F-PA | 56 | CG17956-PA | 1..53 | 5..61 | 152 | 49.2 | Plus |
Mst84Db-PA | 74 | CG17934-PA | 1..59 | 5..60 | 150 | 49.2 | Plus |
Mst84Dd-PA | 72 | CG17935-PA | 14..56 | 15..54 | 149 | 60 | Plus |
Mst84Db-PA | 74 | CG17934-PA | 23..68 | 15..59 | 132 | 53.1 | Plus |