Clone BS12679 Report

Search the DGRC for BS12679

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:126
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptCG31740-RA
Protein status:BS12679.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12679.3prime Sequence

216 bp (216 high quality bases) assembled on 2006-10-13

> BS12679.3prime
ATGGTCTAGAAAGCTTTCACCAGCCGCAAGGACACGAGCTGCAGCCACCA
CAAGGACCACATGGACCACAGCAAGGACTACAGCAACCTCCACAGGGACC
ACATCCGCAATAGGGAGTTCCTCCCATCAAAGGAGCCAGGCAGCCGGGTG
GGCAGGGTCCAACGTAGAAGGGATCGAAGCTGCAGCAAAGCATCAGAACC
ATGTCGACTGATAACT

BS12679.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-PA 186 CG31740-RA 1..186 202..17 930 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 18:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-RA 606 CG31740-RA 220..406 202..16 935 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 18:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009308..18009494 202..16 935 100 Minus
Blast to na_te.dros performed on 2015-02-02 18:08:36 has no hits.

BS12679.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:20 Download gff for BS12679.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-PA 1..186 17..202 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 15:41:34 Download gff for BS12679.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 215..408 13..207 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:13:48 Download gff for BS12679.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 215..408 13..207 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:13:48 Download gff for BS12679.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 18009303..18009496 13..207 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:41:34 Download gff for BS12679.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18009303..18009496 13..207 98   Minus

BS12679.5prime Sequence

216 bp (216 high quality bases) assembled on 2006-10-13

> BS12679.5prime
GAAGTTATCAGTCGACATGGTTCTGATGCTTTGCTGCAGCTTCGATCCCT
TCTACGTTGGACCCTGCCCACCCGGCTGCCTGGCTCCTTTGATGGGAGGA
ACTCCCTATTGCGGATGTGGTCCCTGTGGAGGTTGCTGTAGTCCTTGCTG
TGGTCCATGTGGTCCTTGTGGTGGCTGCAGCTCGTGTCCTTGCGGCTGGT
GAAAGCTTTCTAGACC

BS12679.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-PA 186 CG31740-RA 1..186 17..202 930 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-RA 606 CG31740-RA 220..406 17..203 935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009308..18009494 17..203 935 100 Plus
Blast to na_te.dros performed on 2015-02-10 21:03:27 has no hits.

BS12679.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:21 Download gff for BS12679.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-PA 1..186 17..202 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:24:49 Download gff for BS12679.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 215..408 12..206 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:48:10 Download gff for BS12679.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 215..408 12..206 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:48:10 Download gff for BS12679.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 18009303..18009496 12..206 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:24:49 Download gff for BS12679.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18009303..18009496 12..206 98   Plus

BS12679.complete Sequence

218 bp assembled on 2006-11-01

GenBank Submission: FJ637267

> BS12679.complete
GAAGTTATCAGTCGACATGGTTCTGATGCTTTGCTGCAGCTTCGATCCCT
TCTACGTTGGACCCTGCCCACCCGGCTGCCTGGCTCCTTTGATGGGAGGA
ACTCCCTATTGCGGATGTGGTCCCTGTGGAGGTTGCTGTAGTCCTTGCTG
TGGTCCATGTGGTCCTTGTGGTGGCTGCAGCTCGTGTCCTTGCGGCTGGT
GAAAGCTTTCTAGACCAT

BS12679.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-RA 186 CG31740-PA 1..186 17..202 930 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-RA 606 CG31740-RA 220..406 17..203 935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009308..18009494 17..203 935 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:31:20 has no hits.

BS12679.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:43:29 Download gff for BS12679.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 1..186 17..202 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:17:50 Download gff for BS12679.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 240..433 12..206 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:03:00 Download gff for BS12679.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 220..404 17..201 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:43:30 Download gff for BS12679.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 240..433 12..206 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:21:09 Download gff for BS12679.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 220..404 17..201 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:21:09 Download gff for BS12679.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18009308..18009492 17..201 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:03:00 Download gff for BS12679.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18009308..18009492 17..201 100   Plus

BS12679.pep Sequence

Translation from 16 to 201

> BS12679.pep
MVLMLCCSFDPFYVGPCPPGCLAPLMGGTPYCGCGPCGGCCSPCCGPCGP
CGGCSSCPCGW*

BS12679.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-PA 61 CG31740-PA 1..61 1..61 406 100 Plus
Mst87F-PB 56 CG17956-PB 1..53 5..61 152 49.2 Plus
Mst87F-PA 56 CG17956-PA 1..53 5..61 152 49.2 Plus
Mst84Db-PA 74 CG17934-PA 1..59 5..60 150 49.2 Plus
Mst84Dd-PA 72 CG17935-PA 14..56 15..54 149 60 Plus
Mst84Db-PA 74 CG17934-PA 23..68 15..59 132 53.1 Plus