Clone Sequence Records
BS12681.3prime Sequence
300 bp (300 high quality bases) assembled on 2006-10-13
> BS12681.3prime
ATGGTCTAGAAAGCTTTTATTCGTCGTTCGCGTAGTCAGCGGGGTTCTTG
CGCAGCAGGGCGGTGTGCTTGCGTTCGGTCAGATCGTAGATCAGGTATCC
CACGATGAAGGGGGGAGTAACGATGAAGACGTTGGAGCGGAAGCGACGCA
CCATGTTGGGCAGTCCCTTGCTGATCGCTCCAGCGAAGGCGCGCTGCTCG
AAGGGCGACAGCTTGTAGGTGACGATGCCGTGCACCTTGGCCAAGTTGCC
AAAATGCTGGCCATTCAGGATCGAGGATAGACGCATGTCGACTGATAACT
BS12681.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-PA | 270 | CG7580-RA | 1..270 | 286..17 | 1350 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:20:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-RD | 425 | CG7580-RD | 97..367 | 287..17 | 1355 | 100 | Minus |
CG7580-RC | 625 | CG7580-RC | 297..567 | 287..17 | 1355 | 100 | Minus |
CG7580-RB | 746 | CG7580-RB | 97..367 | 287..17 | 1355 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:20:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 17475419..17475594 | 287..112 | 880 | 100 | Minus |
3L | 28110227 | 3L | 17475651..17475745 | 111..17 | 475 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 16:20:22 has no hits.
BS12681.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:22 Download gff for
BS12681.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-PA | 1..270 | 17..286 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:12:52 Download gff for
BS12681.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 91..369 | 13..294 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:46:04 Download gff for
BS12681.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 91..369 | 13..294 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:46:04 Download gff for
BS12681.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17475413..17475594 | 112..294 | 97 | -> | Minus |
3L | 17475651..17475747 | 13..111 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:12:52 Download gff for
BS12681.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 17468513..17468694 | 112..294 | 97 | -> | Minus |
arm_3L | 17468751..17468847 | 13..111 | 97 | | Minus |
BS12681.5prime Sequence
300 bp (300 high quality bases) assembled on 2006-10-13
> BS12681.5prime
GAAGTTATCAGTCGACATGCGTCTATCCTCGATCCTGAATGGCCAGCATT
TTGGCAACTTGGCCAAGGTGCACGGCATCGTCACCTACAAGCTGTCGCCC
TTCGAGCAGCGCGCCTTCGCTGGAGCGATCAGCAAGGGACTGCCCAACAT
GGTGCGTCGCTTCCGCTCCAACGTCTTCATCGTTACTCCCCCCTTCATCG
TGGGATACCTGATCTACGATCTGACCGAACGCAAGCACACCGCCCTGCTG
CGCAAGAACCCCGCTGACTACGCGAACGACGAATAAAAGCTTTCTAGACC
BS12681.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:29:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-PA | 270 | CG7580-RA | 1..270 | 17..286 | 1350 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 06:43:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-RD | 425 | CG7580-RD | 97..367 | 16..286 | 1355 | 100 | Plus |
CG7580-RC | 625 | CG7580-RC | 297..567 | 16..286 | 1355 | 100 | Plus |
CG7580-RB | 746 | CG7580-RB | 97..367 | 16..286 | 1355 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 06:43:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 17475419..17475594 | 16..191 | 880 | 100 | Plus |
3L | 28110227 | 3L | 17475651..17475745 | 192..286 | 475 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-03 06:43:21 has no hits.
BS12681.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:32:22 Download gff for
BS12681.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-PA | 1..270 | 17..286 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:31:01 Download gff for
BS12681.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 91..369 | 9..290 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:38:54 Download gff for
BS12681.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 91..369 | 9..290 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:38:54 Download gff for
BS12681.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17475413..17475594 | 9..191 | 97 | -> | Plus |
3L | 17475651..17475747 | 192..290 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:31:01 Download gff for
BS12681.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 17468513..17468694 | 9..191 | 97 | -> | Plus |
arm_3L | 17468751..17468847 | 192..290 | 97 | | Plus |
BS12681.complete Sequence
302 bp assembled on 2006-11-01
GenBank Submission: FJ637269
> BS12681.complete
GAAGTTATCAGTCGACATGCGTCTATCCTCGATCCTGAATGGCCAGCATT
TTGGCAACTTGGCCAAGGTGCACGGCATCGTCACCTACAAGCTGTCGCCC
TTCGAGCAGCGCGCCTTCGCTGGAGCGATCAGCAAGGGACTGCCCAACAT
GGTGCGTCGCTTCCGCTCCAACGTCTTCATCGTTACTCCCCCCTTCATCG
TGGGATACCTGATCTACGATCTGACCGAACGCAAGCACACCGCCCTGCTG
CGCAAGAACCCCGCTGACTACGCGAACGACGAATAAAAGCTTTCTAGACC
AT
BS12681.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:04:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-RD | 270 | CG7580-PD | 1..270 | 17..286 | 1350 | 100 | Plus |
CG7580-RC | 270 | CG7580-PC | 1..270 | 17..286 | 1350 | 100 | Plus |
CG7580-RB | 270 | CG7580-PB | 1..270 | 17..286 | 1350 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:04:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-RD | 425 | CG7580-RD | 97..367 | 16..286 | 1355 | 100 | Plus |
CG7580-RC | 625 | CG7580-RC | 297..567 | 16..286 | 1355 | 100 | Plus |
CG7580-RB | 746 | CG7580-RB | 97..367 | 16..286 | 1355 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:04:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 17475419..17475594 | 16..191 | 880 | 100 | Plus |
3L | 28110227 | 3L | 17475651..17475745 | 192..286 | 475 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 14:04:36 has no hits.
BS12681.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:17:12 Download gff for
BS12681.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RA | 1..270 | 17..286 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:36 Download gff for
BS12681.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RA | 320..598 | 9..290 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:54 Download gff for
BS12681.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 98..365 | 17..284 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:17:12 Download gff for
BS12681.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RA | 320..598 | 9..290 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:02:42 Download gff for
BS12681.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 98..365 | 17..284 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:02:42 Download gff for
BS12681.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17475420..17475594 | 17..191 | 100 | -> | Plus |
3L | 17475651..17475743 | 192..284 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:54 Download gff for
BS12681.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 17468520..17468694 | 17..191 | 100 | -> | Plus |
arm_3L | 17468751..17468843 | 192..284 | 100 | | Plus |
BS12681.pep Sequence
Translation from 16 to 285
> BS12681.pep
MRLSSILNGQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFR
SNVFIVTPPFIVGYLIYDLTERKHTALLRKNPADYANDE*
BS12681.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:20:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-PD | 89 | CG7580-PD | 1..89 | 1..89 | 460 | 100 | Plus |
CG7580-PC | 89 | CG7580-PC | 1..89 | 1..89 | 460 | 100 | Plus |
CG7580-PB | 89 | CG7580-PB | 1..89 | 1..89 | 460 | 100 | Plus |
CG7580-PA | 89 | CG7580-PA | 1..89 | 1..89 | 460 | 100 | Plus |