Clone BS12683 Report

Search the DGRC for BS12683

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:126
Well:83
Vector:pDNR-Dual
Associated Gene/Transcriptobsolete transcript model
Protein status:BS12683.pep:
Sequenced Size:16

Clone Sequence Records

BS12683.5prime Sequence

312 bp (312 high quality bases) assembled on 2006-10-13

> BS12683.5prime
GAAGTTATCCCTCGACATGGAAGACAAAATTCTGACATACCAGTTTACAA
GGAACAATGCCCGTTGGACTGCGAGGGACCATGGAGAGCCTATTGCAAAT
ACACTTGCAAACATTGTAAGGACATCAACCAGCAGAAGGAGACCTGTGCA
CCGGCACCGCTTAACGCGTCAAGTTAAGCCAGTAAGGGCACCTCTAACCA
CCAACAACAGCAGCTTGGGCAGCAGGCACCGGCACCGTATGGAAAGGAAA
AGGAAACCGACAGCGCTTCCGAGAGCGCAATTTTTTTTTTCTCAATAGAA
GCTTTCTAGACC

BS12683.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed on 2007-05-11 11:29:56 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-12 11:11:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:10:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 24265818..24266080 36..298 1315 100 Plus
3R 32079331 3R 3360499..3360586 289..202 350 93.2 Minus
3R 32079331 3R 3360598..3360778 214..36 350 81.5 Minus
U 3151297 U 1329240..1329397 192..36 315 82 Minus
Blast to na_te.dros performed 2015-02-12 11:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 799..1097 36..300 1047 86.6 Plus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 824..909 36..118 180 69.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2335..2403 197..264 125 70 Plus
roo 9092 roo DM_ROO 9092bp 1041..1155 111..237 101 61.7 Plus

BS12683.5prime Sim4 Records

Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:31:37 Download gff for BS12683.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 24265575..24265593 17..35 100 -> Plus
3L 24265818..24266084 36..303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:31:37 Download gff for BS12683.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 24265575..24265593 17..35 100 -> Plus
3L 24265818..24266084 36..303 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:45:24 Download gff for BS12683.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 24258675..24258693 17..35 100 -> Plus
arm_3L 24258918..24259184 36..303 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:45:24 Download gff for BS12683.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 24258675..24258693 17..35 100 -> Plus
arm_3L 24258918..24259184 36..303 99   Plus

BS12683.complete Sequence

314 bp assembled on 2006-11-01

> BS12683.complete
GAAGTTATCAGTCGACATGGAAGACAAAATTCTGACATACCAGTTTACAA
GGAACAATGCCCGTTGGACTGCGAGGGACCATGGAGAGCCTATTGCAAAT
ACACTTGCAAACATTGTAAGGACATCAACCAGCAGAAGGAGACCTGTGCA
CCGGCACCGCTTAACGCGTCAAGTTAAGCCAGTAAGGGCACCTCTAACCA
CCAACAACAGCAGCTTGGGCAGCAGGCACCGGCACCGTATGGAAAGGAAA
AGGAAACCGACAGCGCTTCCGAGAGCGCAATTTTTTTTTTCTCAATAGAA
GCTTTCTAGACCAT

BS12683.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 16:39:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 16:39:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 24265818..24266080 36..298 1315 100 Plus
3R 32079331 3R 3360499..3360586 289..202 350 93.2 Minus
3R 32079331 3R 3360598..3360778 214..36 350 81.5 Minus
U 3151297 U 1329240..1329397 192..36 315 82 Minus
Y 3667352 Y 377846..378003 36..192 315 82 Plus
Blast to na_te.dros performed 2014-11-27 16:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 799..1097 36..300 1047 86.6 Plus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 824..909 36..118 180 69.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2335..2403 197..264 125 70 Plus
roo 9092 roo DM_ROO 9092bp 1041..1155 111..237 101 61.7 Plus

BS12683.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 14:18:34 has no hits.
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 14:18:35 has no hits.
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:23:35 Download gff for BS12683.complete
Subject Subject Range Query Range Percent Splice Strand
3L 24265575..24265593 17..35 100 -> Plus
3L 24265818..24266080 36..298 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:23:35 Download gff for BS12683.complete
Subject Subject Range Query Range Percent Splice Strand
3L 24265575..24265593 17..35 100 -> Plus
3L 24265818..24266080 36..298 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:57:43 Download gff for BS12683.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 24258675..24258693 17..35 100 -> Plus
arm_3L 24258918..24259180 36..298 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:57:43 Download gff for BS12683.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 24258675..24258693 17..35 100 -> Plus
arm_3L 24258918..24259180 36..298 100   Plus

BS12683.pep Sequence

Translation from 16 to 297

> BS12683.pep
MEDKILTYQFTRNNARWTARDHGEPIANTLANIVRTSTSRRRPVHRHRLT
RQVKPVRAPLTTNNSSLGSRHRHRMERKRKPTALPRAQFFFSQ*
Sequence BS12683.pep has no blast hits.