Clone BS12939 Report

Search the DGRC for BS12939

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:129
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptRpL31-RA
Protein status:BS12939.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS12939.3prime Sequence

405 bp (405 high quality bases) assembled on 2006-10-13

> BS12939.3prime
ATGGTCTAGAAAGCTTTTAGTCGTCGCTGGACTCGACATTCTCGGTCTGC
AAGTTCTTGAACGTGGACACCGGCACATAGGTCACGTAAGTGTACAGCTT
GTTGGGGGAGTCCTCATCGTCGTTGCGGCGACGCGCCAGGCGCACGCGAA
TGCGGAATGGAGTGGACCTGATACCCTTGGACCAGATGTGCTTGTTCAGA
CGGGTGTCGATCCTCACATCGGTGGTGCCCATCTCCCGCTCGGCGAACTT
GCGGATCTCCTTGATGGCGCGGGGTGCGCGCTTCTTGAAGCCGATGTTGT
GGACACGCTTGGCCAAGTGAATGGTGCACTCGCGCGTCACGACTTCGTTG
ATCGCGGATTTGTTGATTTTCTCACCCTTGGTCTTGGTCATGTCGACTGA
TAACT

BS12939.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG1821-PC 375 RpL31-RC 1..375 391..17 1875 100 Minus
CG1821-PB 375 RpL31-RB 1..375 391..17 1875 100 Minus
CG1821-PA 375 RpL31-RA 1..375 391..17 1875 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 10:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
RpL31-RA 509 CG1821-RA 73..447 391..17 1875 100 Minus
RpL31-RB 577 CG1821-RB 141..515 391..17 1875 100 Minus
RpL31-RC 522 CG1821-RC 86..460 391..17 1875 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 10:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9587483..9587708 391..166 1130 100 Minus
2R 25286936 2R 9587774..9587927 170..17 770 100 Minus
Blast to na_te.dros performed on 2015-01-31 10:20:12 has no hits.

BS12939.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:35:08 Download gff for BS12939.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1821-PA 1..375 17..391 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:36:58 Download gff for BS12939.3prime
Subject Subject Range Query Range Percent Splice Strand
RpL31-RC 79..462 13..399 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:46:00 Download gff for BS12939.3prime
Subject Subject Range Query Range Percent Splice Strand
RpL31-RC 79..462 13..399 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:46:00 Download gff for BS12939.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 9587476..9587706 168..399 98 -> Minus
2R 9587777..9587929 13..167 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:36:58 Download gff for BS12939.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5474981..5475211 168..399 98 -> Minus
arm_2R 5475282..5475434 13..167 98   Minus

BS12939.5prime Sequence

405 bp (405 high quality bases) assembled on 2006-10-13

> BS12939.5prime
GAAGTTATCAGTCGACATGACCAAGACCAAGGGTGAGAAAATCAACAAAT
CCGCGATCAACGAAGTCGTGACGCGCGAGTGCACCATTCACTTGGCCAAG
CGTGTCCACAACATCGGCTTCAAGAAGCGCGCACCCCGCGCCATCAAGGA
GATCCGCAAGTTCGCCGAGCGGGAGATGGGCACCACCGATGTGAGGATCG
ACACCCGTCTGAACAAGCACATCTGGTCCAAGGGTATCAGGTCCACTCCA
TTCCGCATTCGCGTGCGCCTGGCGCGTCGCCGCAACGACGATGAGGACTC
CCCCAACAAGCTGTACACTTACGTGACCTATGTGCCGGTGTCCACGTTCA
AGAACTTGCAGACCGAGAATGTCGAGTCCAGCGACGACTAAAAGCTTTCT
AGACC

BS12939.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG1821-PC 375 RpL31-RC 1..375 17..391 1875 100 Plus
CG1821-PB 375 RpL31-RB 1..375 17..391 1875 100 Plus
CG1821-PA 375 RpL31-RA 1..375 17..391 1875 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
RpL31-RA 509 CG1821-RA 73..447 17..391 1875 100 Plus
RpL31-RB 577 CG1821-RB 141..515 17..391 1875 100 Plus
RpL31-RC 522 CG1821-RC 86..460 17..391 1875 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9587483..9587708 17..242 1130 100 Plus
2R 25286936 2R 9587774..9587927 238..391 770 100 Plus
Blast to na_te.dros performed on 2015-02-11 09:13:25 has no hits.

BS12939.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:35:08 Download gff for BS12939.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1821-PA 1..375 17..391 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:04:01 Download gff for BS12939.5prime
Subject Subject Range Query Range Percent Splice Strand
RpL31-RC 79..462 9..395 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 11:27:20 Download gff for BS12939.5prime
Subject Subject Range Query Range Percent Splice Strand
RpL31-RC 79..462 9..395 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 11:27:20 Download gff for BS12939.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 9587476..9587706 9..240 98 -> Plus
2R 9587777..9587929 241..395 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:04:01 Download gff for BS12939.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5474981..5475211 9..240 98 -> Plus
arm_2R 5475282..5475434 241..395 98   Plus

BS12939.complete Sequence

407 bp assembled on 2006-11-01

GenBank Submission: FJ637337

> BS12939.complete
GAAGTTATCAGTCGACATGACCAAGACCAAGGGTGAGAAAATCAACAAAT
CCGCGATCAACGAAGTCGTGACGCGCGAGTGCACCATTCACTTGGCCAAG
CGTGTCCACAACATCGGCTTCAAGAAGCGCGCACCCCGCGCCATCAAGGA
GATCCGCAAGTTCGCCGAGCGGGAGATGGGCACCACCGATGTGAGGATCG
ACACCCGTCTGAACAAGCACATCTGGTCCAAGGGTATCAGGTCCACTCCA
TTCCGCATTCGCGTGCGCCTGGCGCGTCGCCGCAACGACGATGAGGACTC
CCCCAACAAGCTGTACACTTACGTGACCTATGTGCCGGTGTCCACGTTCA
AGAACTTGCAGACCGAGAATGTCGAGTCCAGCGACGACTAAAAGCTTTCT
AGACCAT

BS12939.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
RpL31-RA 375 CG1821-PA 1..375 17..391 1875 100 Plus
RpL31-RB 375 CG1821-PB 1..375 17..391 1875 100 Plus
RpL31-RC 375 CG1821-PC 1..375 17..391 1875 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
RpL31-RA 509 CG1821-RA 73..447 17..391 1875 100 Plus
RpL31-RB 577 CG1821-RB 141..515 17..391 1875 100 Plus
RpL31-RC 522 CG1821-RC 86..460 17..391 1875 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9587483..9587708 17..242 1130 100 Plus
2R 25286936 2R 9587774..9587927 238..391 770 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:57:42 has no hits.

BS12939.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:42:14 Download gff for BS12939.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RA 1..375 17..391 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:16:19 Download gff for BS12939.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RC 79..462 9..395 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:14:33 Download gff for BS12939.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RC 86..458 17..389 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:42:14 Download gff for BS12939.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RC 79..462 9..395 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:29:32 Download gff for BS12939.complete
Subject Subject Range Query Range Percent Splice Strand
RpL31-RC 86..458 17..389 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:29:32 Download gff for BS12939.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9587483..9587706 17..240 100 -> Plus
2R 9587777..9587925 241..389 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:14:33 Download gff for BS12939.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5474988..5475211 17..240 100 -> Plus
arm_2R 5475282..5475430 241..389 100   Plus

BS12939.pep Sequence

Translation from 16 to 390

> BS12939.pep
MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFA
EREMGTTDVRIDTRLNKHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLY
TYVTYVPVSTFKNLQTENVESSDD*

BS12939.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpL31-PA 124 CG1821-PA 1..124 1..124 639 100 Plus
RpL31-PB 124 CG1821-PB 1..124 1..124 639 100 Plus
RpL31-PC 124 CG1821-PC 1..124 1..124 639 100 Plus