Clone BS13105 Report

Search the DGRC for BS13105

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:131
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG30197-RA
Protein status:BS13105.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS13105.5prime Sequence

372 bp (372 high quality bases) assembled on 2006-10-13

> BS13105.5prime
GAAGTTATCAGTCGACATGGTTAAGCTCGGCTTTCTTTCACTGTTAATTG
CTGCCTGTGTGGTTGCTGCCTTTGCTGCGGGTGATTGTCCTTCATCCACC
AAGGTTCAGAACTGTACGCCAAAATGCCTGCATGACAGCGAGTGCAGCGC
CATCGGCGGAAAATGCTGTCCGAATTTGTGCAACGGTCGCAGTTGTGCTC
AACCGAATGTCCTGGGAAATTCTGGAGCCGATAAATCGCCCTTCGGCAGC
AAGAACTCTGGAGCTACTGGCAGTTATTGCGGCAATGTCAAGTGCGGCAG
CTTTGAGAAATGCGAAATGGATCGCAGCACCAAGCGACCCAAGTGCGTGA
GATCGTGAAAGCTTTCTAGACC

BS13105.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-PA 342 CG30197-RA 1..342 17..358 1710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-RA 481 CG30197-RA 51..395 16..360 1725 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14514282..14514456 83..257 875 100 Plus
2R 25286936 2R 14514804..14514906 258..360 515 100 Plus
2R 25286936 2R 14514152..14514215 20..83 320 100 Plus
Blast to na_te.dros performed on 2015-02-10 17:34:52 has no hits.

BS13105.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:37:15 Download gff for BS13105.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-PA 1..342 17..358 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:26:53 Download gff for BS13105.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 41..391 6..360 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:10:12 Download gff for BS13105.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 45..395 6..360 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:10:12 Download gff for BS13105.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 14514150..14514215 16..83 97 -> Plus
2R 14514283..14514456 84..257 100 -> Plus
2R 14514804..14514906 258..360 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:26:53 Download gff for BS13105.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10401655..10401720 16..83 97 -> Plus
arm_2R 10401788..10401961 84..257 100 -> Plus
arm_2R 10402309..10402411 258..360 100   Plus

BS13105.3prime Sequence

372 bp (372 high quality bases) assembled on 2006-10-13

> BS13105.3prime
ATGGTCTAGAAAGCTTTCACGATCTCACGCACTTGGGTCGCTTGGTGCTG
CGATCCATTTCGCATTTCTCAAAGCTGCCGCACTTGACATTGCCGCAATA
ACTGCCAGTAGCTCCAGAGTTCTTGCTGCCGAAGGGCGATTTATCGGCTC
CAGAATTTCCCAGGACATTCGGTTGAGCACAACTGCGACCGTTGCACAAA
TTCGGACAGCATTTTCCGCCGATGGCGCTGCACTCGCTGTCATGCAGGCA
TTTTGGCGTACAGTTCTGAACCTTGGTGGATGAAGGACAATCACCCGCAG
CAAAGGCAGCAACCACACAGGCAGCAATTAACAGTGAAAGAAAGCCGAGC
TTAACCATGTCGACTGATAACT

BS13105.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-PA 342 CG30197-RA 1..342 358..17 1710 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-RA 481 CG30197-RA 51..395 359..15 1725 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14514282..14514456 292..118 875 100 Minus
2R 25286936 2R 14514804..14514906 117..15 515 100 Minus
2R 25286936 2R 14514152..14514215 355..292 320 100 Minus
Blast to na_te.dros performed on 2015-02-12 04:06:19 has no hits.

BS13105.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:37:15 Download gff for BS13105.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-PA 1..342 17..358 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:34:49 Download gff for BS13105.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 41..391 15..369 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:09:08 Download gff for BS13105.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 45..395 15..369 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:09:08 Download gff for BS13105.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 14514150..14514215 292..359 97 -> Minus
2R 14514283..14514456 118..291 100 -> Minus
2R 14514804..14514906 15..117 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:34:49 Download gff for BS13105.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10401655..10401720 292..359 97 -> Minus
arm_2R 10401788..10401961 118..291 100 -> Minus
arm_2R 10402309..10402411 15..117 100   Minus

BS13105.complete Sequence

374 bp assembled on 2006-11-01

GenBank Submission: FJ637385

> BS13105.complete
GAAGTTATCAGTCGACATGGTTAAGCTCGGCTTTCTTTCACTGTTAATTG
CTGCCTGTGTGGTTGCTGCCTTTGCTGCGGGTGATTGTCCTTCATCCACC
AAGGTTCAGAACTGTACGCCAAAATGCCTGCATGACAGCGAGTGCAGCGC
CATCGGCGGAAAATGCTGTCCGAATTTGTGCAACGGTCGCAGTTGTGCTC
AACCGAATGTCCTGGGAAATTCTGGAGCCGATAAATCGCCCTTCGGCAGC
AAGAACTCTGGAGCTACTGGCAGTTATTGCGGCAATGTCAAGTGCGGCAG
CTTTGAGAAATGCGAAATGGATCGCAGCACCAAGCGACCCAAGTGCGTGA
GATCGTGAAAGCTTTCTAGACCAT

BS13105.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-RA 342 CG30197-PA 1..342 17..358 1710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-RA 481 CG30197-RA 51..395 16..360 1725 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14514282..14514456 83..257 875 100 Plus
2R 25286936 2R 14514804..14514906 258..360 515 100 Plus
2R 25286936 2R 14514152..14514215 20..83 320 100 Plus
Blast to na_te.dros performed on 2014-11-27 19:44:29 has no hits.

BS13105.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:47:07 Download gff for BS13105.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 1..342 17..358 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:34:59 Download gff for BS13105.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 41..391 6..360 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:02:45 Download gff for BS13105.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 48..388 17..357 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:47:07 Download gff for BS13105.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 41..391 6..360 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:07:27 Download gff for BS13105.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 52..392 17..357 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:07:27 Download gff for BS13105.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14514151..14514215 17..83 97 -> Plus
2R 14514283..14514456 84..257 100 -> Plus
2R 14514804..14514903 258..357 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:02:45 Download gff for BS13105.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10401656..10401720 17..83 97 -> Plus
arm_2R 10401788..10401961 84..257 100 -> Plus
arm_2R 10402309..10402408 258..357 100   Plus

BS13105.pep Sequence

Translation from 16 to 357

> BS13105.pep
MVKLGFLSLLIAACVVAAFAAGDCPSSTKVQNCTPKCLHDSECSAIGGKC
CPNLCNGRSCAQPNVLGNSGADKSPFGSKNSGATGSYCGNVKCGSFEKCE
MDRSTKRPKCVRS*

BS13105.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-PA 113 CG30197-PA 1..113 1..113 621 100 Plus