Clone BS13421 Report

Search the DGRC for BS13421

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:134
Well:21
Vector:pDNR-Dual
Associated Gene/Transcriptlevy-RA
Protein status:BS13421.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS13421.3prime Sequence

360 bp (360 high quality bases) assembled on 2006-10-13

> BS13421.3prime
ATGGTCTAGAAAGCTTCTAGTGCTCGTAGCCGTCGGGCAGGGCGTTAACG
TGGGGGTTGTGGAACAGGCTCTTCTGGCCCTCACCCCAGGGGAAGCGCTT
CTCGCGGCGGCGCAGGTAGTCGTACTTGACGAACTCCTGGCGGGGCTTGT
CGTGCTCCTCCTGGTGCTTCAGGTAGGCGTTCAGCATGCACAGTCCCACG
GCGGGCACGGCCACGAAGAAGGACAGGCGCTTCCACACCTTGTAGCCACC
AGAGTGCTCGCCGGCCACGGCGGCGGTGCCGGACATATTCCGGGCGGCAG
AAGCGCCGAATTGGCGGCGAATTGCGTGGTTTAGAATAGCGGACATGTCG
ACTGATAACT

BS13421.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG17280-PA 330 CG17280-RA 1..330 346..17 1650 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
levy-RB 490 CG17280-RB 52..381 346..17 1650 100 Minus
levy-RA 593 CG17280-RA 52..381 346..17 1650 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23548537..23548770 250..17 1170 100 Minus
2R 25286936 2R 23548290..23548388 346..248 495 100 Minus
Blast to na_te.dros performed on 2015-02-11 17:23:19 has no hits.

BS13421.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:40:38 Download gff for BS13421.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17280-PA 1..330 17..346 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:21:06 Download gff for BS13421.3prime
Subject Subject Range Query Range Percent Splice Strand
levy-RA 52..381 17..346 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:09:52 Download gff for BS13421.3prime
Subject Subject Range Query Range Percent Splice Strand
levy-RA 52..381 17..346 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:09:52 Download gff for BS13421.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 23548290..23548386 250..346 100 -> Minus
2R 23548538..23548770 17..249 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:21:06 Download gff for BS13421.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19435813..19435909 250..346 100 -> Minus
arm_2R 19436061..19436293 17..249 100   Minus

BS13421.5prime Sequence

360 bp (360 high quality bases) assembled on 2006-10-13

> BS13421.5prime
GAAGTTATCAGTCGACATGTCCGCTATTCTAAACCACGCAATTCGCCGCC
AATTCGGCGCTTCTGCCGCCCGGAATATGTCCGGCACCGCCGCCGTGGCC
GGCGAGCACTCTGGTGGCTACAAGGTGTGGAAGCGCCTGTCCTTCTTCGT
GGCCGTGCCCGCCGTGGGACTGTGCATGCTGAACGCCTACCTGAAGCACC
AGGAGGAGCACGACAAGCCCCGCCAGGAGTTCGTCAAGTACGACTACCTG
CGCCGCCGCGAGAAGCGCTTCCCCTGGGGTGAGGGCCAGAAGAGCCTGTT
CCACAACCCCCACGTTAACGCCCTGCCCGACGGCTACGAGCACTAGAAGC
TTTCTAGACC

BS13421.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG17280-PA 330 CG17280-RA 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
levy-RB 490 CG17280-RB 52..381 17..346 1650 100 Plus
levy-RA 593 CG17280-RA 52..381 17..346 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23548537..23548770 113..346 1170 100 Plus
2R 25286936 2R 23548290..23548388 17..115 495 100 Plus
Blast to na_te.dros performed on 2015-02-10 21:00:30 has no hits.

BS13421.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:40:38 Download gff for BS13421.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17280-PA 1..330 17..346 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 08:09:14 Download gff for BS13421.5prime
Subject Subject Range Query Range Percent Splice Strand
levy-RA 52..381 17..346 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:41:30 Download gff for BS13421.5prime
Subject Subject Range Query Range Percent Splice Strand
levy-RA 52..381 17..346 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:41:30 Download gff for BS13421.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 23548290..23548386 17..113 100 -> Plus
2R 23548538..23548770 114..346 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 08:09:14 Download gff for BS13421.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19435813..19435909 17..113 100 -> Plus
arm_2R 19436061..19436293 114..346 100   Plus

BS13421.complete Sequence

362 bp assembled on 2006-11-01

GenBank Submission: FJ637446

> BS13421.complete
GAAGTTATCAGTCGACATGTCCGCTATTCTAAACCACGCAATTCGCCGCC
AATTCGGCGCTTCTGCCGCCCGGAATATGTCCGGCACCGCCGCCGTGGCC
GGCGAGCACTCTGGTGGCTACAAGGTGTGGAAGCGCCTGTCCTTCTTCGT
GGCCGTGCCCGCCGTGGGACTGTGCATGCTGAACGCCTACCTGAAGCACC
AGGAGGAGCACGACAAGCCCCGCCAGGAGTTCGTCAAGTACGACTACCTG
CGCCGCCGCGAGAAGCGCTTCCCCTGGGGTGAGGGCCAGAAGAGCCTGTT
CCACAACCCCCACGTTAACGCCCTGCCCGACGGCTACGAGCACTAGAAGC
TTTCTAGACCAT

BS13421.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
levy-RB 330 CG17280-PB 1..330 17..346 1650 100 Plus
levy-RA 330 CG17280-PA 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
levy-RB 490 CG17280-RB 52..381 17..346 1650 100 Plus
levy-RA 593 CG17280-RA 52..381 17..346 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23548537..23548770 113..346 1170 100 Plus
2R 25286936 2R 23548290..23548388 17..115 495 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:00:34 has no hits.

BS13421.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:40:08 Download gff for BS13421.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 1..330 17..346 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:13:46 Download gff for BS13421.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 51..380 17..346 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:35:57 Download gff for BS13421.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 52..381 17..346 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:40:08 Download gff for BS13421.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 51..380 17..346 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:57:51 Download gff for BS13421.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 52..381 17..346 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:57:51 Download gff for BS13421.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23548290..23548386 17..113 100 -> Plus
2R 23548538..23548770 114..346 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:35:57 Download gff for BS13421.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19435813..19435909 17..113 100 -> Plus
arm_2R 19436061..19436293 114..346 100   Plus

BS13421.pep Sequence

Translation from 16 to 345

> BS13421.pep
MSAILNHAIRRQFGASAARNMSGTAAVAGEHSGGYKVWKRLSFFVAVPAV
GLCMLNAYLKHQEEHDKPRQEFVKYDYLRRREKRFPWGEGQKSLFHNPHV
NALPDGYEH*

BS13421.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
levy-PB 109 CG17280-PB 1..109 1..109 590 100 Plus
levy-PA 109 CG17280-PA 1..109 1..109 590 100 Plus
CG30093-PA 94 CG30093-PA 19..87 37..108 234 56.9 Plus
CG14077-PB 289 CG14077-PB 153..229 27..108 141 36.1 Plus
CG14077-PC 289 CG14077-PC 153..229 27..108 141 36.1 Plus